KEGG   Methylobacterium sp. DM1: C0214_04815Help
Entry
C0214_04815       CDS       T05461                                 

Definition
(GenBank) adenylate/guanylate cyclase domain-containing protein
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
metd  Methylobacterium sp. DM1
Pathway
metd00230  Purine metabolism
metd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:metd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C0214_04815
Enzymes [BR:metd01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     C0214_04815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CHASE2 Guanylate_cyc
Motif
Other DBs
NCBI-ProteinID: AWI87686
UniProt: A0A2U8HRY8
LinkDB All DBs
Position
complement(1023538..1025409)
Genome map
AA seq 623 aa AA seqDB search
MPGFESISTHHRINRRFALLVLVAALGWSGWLSHLHIAGRATPVDYLEAALTDLRLRLAG
PRKPPADIAIVAIDDEFVRREGGFPISRATMARLIEVIATARPRALAVDVLFLEDGRQPE
ADHALAAALAKVPAVLAAAAVFDDAANEDGIPVATALHRPTPVIGATALSGLVNLSEDAA
GVPRHLPLVTRTNEGVAAAFALRAAALAARSDPVLSEGEVRIGSSVIPLDLGYHLPLRPF
GPRRTIQTFGAAALLDATVPAAVLADRIVVIGATALGGSDTFATAFDPVMPGVELLATGI
AHLTTGAGLVRDVWVRRLDALAAMAIAGAAVLLIAMVSPLSAAPLVLLILTTWLAIGTFA
FSQGIWLSAALPLAAAGLPALLCAAARQAIDRQQSVRLARSEQALRQLQPAALADRLAWD
PTYLASPLTREIPVLFIDLTGFTGQSERLGPVRTREILKTFHDLVDETASSHGGLVVNFM
GDGAMVVFGALDPDPARAENAVRAAEDLIVRTRDWIERDAELVGAGRALDVRIGAHYGPA
ILSRLGSDTNQHVTATGDTVNVASRLLAVASEAKSRLAVSADLLTAAGIDEPGAVFEERR
TTALRGRSQPIEVWLKLDPSPRQ
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgccgggctttgagtcgatctcaacacaccaccggatcaaccgacgcttcgccctcctc
gtgctcgtcgccgcgctcgggtggagcggctggctctctcacctgcacatcgccggacgg
gcgacgccggtcgactacctcgaagcggccctgacggatttgcgtctgaggctggccggt
ccacgcaagccgccggccgacatcgcgatcgtcgccatcgacgacgaattcgtccgccgg
gaaggaggctttcccatctcgcgcgcgacgatggcgcggcttatcgaggttatcgcgacc
gctcgcccgcgcgcgctggccgtcgatgttctgttcctggaagacgggcgccagccggag
gcggatcatgcccttgccgccgctctcgccaaggtgcccgccgtcttggcggcggccgct
gttttcgacgatgcggcgaatgaggatggcatcccggtcgccaccgcattgcatcgtccg
acaccggtgatcggcgcaacggcgctgtcggggctcgtcaacctgtccgaggacgccgcc
ggcgtgccgcggcaccttcctcttgttaccagaacgaacgagggtgtagccgcagccttt
gccctgcgcgcagcggccctggcagctcggagcgatccggtcctaagcgagggagaggtt
cggatcgggtcttccgtcatcccgctcgatctcggctatcaccttcccctccgtcccttc
gggccgcggcgcacgatccaaacgttcggtgccgccgcactcctcgatgcgaccgtaccg
gccgccgttctggccgaccgcatcgtcgtgattggagcgacggcgctggggggaagcgac
acctttgcaacggccttcgatcccgtgatgcccggtgtcgaactgcttgccaccggcatc
gcccacctgactaccggcgccggcctcgtgcgcgatgtgtgggttcgccgcctcgacgcc
ttggcagctatggctatcgcgggcgcggccgtgctcctgattgcaatggtctctcctctc
tcggcggcccccctcgttctcctcatcctgacgacatggcttgctatcggcacctttgcc
tttagccagggcatatggttgagcgccgccctgccgctcgcagccgccggactgccggcc
ctcctgtgcgcggcagcacggcaggcgatcgatcgtcagcagagcgtgaggctcgcacga
tcggaacaggccctgcgccagcttcaacccgccgcgctcgcggatcggctcgcctgggat
ccgacctatctggcttcacccctcacgcgtgaaatcccggtgctcttcatcgatctcacc
ggcttcaccggccagagtgagcgcctcggcccggtgcgcacccgcgaaatcctcaagacg
tttcacgatctggtggacgagaccgcctcatctcacggaggccttgtcgtcaacttcatg
ggcgatggtgcgatggtcgtgttcggtgcgctggatcccgatcccgccagggcagagaac
gccgtgcgggccgccgaagatctcatcgtacgcacccgcgactggatcgagcgcgacgcc
gagctggtaggcgccggacgcgcgctcgacgtgcggatcggcgcacattatggaccggcc
atcctctcgcgtctcggcagcgataccaatcagcacgtcacagcgacgggcgatacggtc
aacgtcgcgagccgcctgctcgctgttgcttcggaagccaagtcacgcctcgccgtcagc
gccgatctcctgacagccgccggtatcgatgagccgggcgccgtcttcgaggagcggcgg
acgacggccctgcgcgggcggtctcaacccatcgaggtttggctgaagctcgatccgagt
ccccggcaatag

DBGET integrated database retrieval system