KEGG   Methylobacterium sp. DM1: C0214_09600Help
Entry
C0214_09600       CDS       T05461                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
metd  Methylobacterium sp. DM1
Pathway
metd00020  Citrate cycle (TCA cycle)
metd00310  Lysine degradation
metd00380  Tryptophan metabolism
metd01100  Metabolic pathways
metd01110  Biosynthesis of secondary metabolites
metd01120  Microbial metabolism in diverse environments
metd01130  Biosynthesis of antibiotics
metd01200  Carbon metabolism
Module
metd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
metd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:metd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C0214_09600 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    C0214_09600 (sucA)
   00380 Tryptophan metabolism
    C0214_09600 (sucA)
Enzymes [BR:metd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     C0214_09600 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AWI88480
UniProt: A0A2U8HS64
LinkDB All DBs
Position
complement(2016733..2019723)
Genome map
AA seq 996 aa AA seqDB search
MARQDANEALLQTSFLYGANAAWIEELQAAYARDPNSVDPEWQQFFKELGEDDALVKKNA
EGASWAKPNWPVPLNGEIVSALDGNWGALERALGEKIQAKAQPGKPGDSAKGAAIVAATG
VSVEQATKDSVRAIMLIRAYRMRGHLHAKLDPIGLAPRGDHEELHPQHYGFQESDWDRKI
FLDNVLGMEFSTIREIVGILERTYCQTLGVEFMHISDPEEKAWLQERIEGKDKEISFTPE
GRRAILNKLIEAEGFEKFLDLKYTGTKRFGLDGGESMVPALEQIIKRGGALGVEEIVLGM
AHRGRLNVLTNVMAKPFRAVFHEFKGGSASPAEVEGSGDVKYHLGASSDRAFDDNTVHLS
LTANPSHLEIVDPVVLGKVRAKQDQKAKPNVERRKVLPLLIHGDAAFAGQGVVAECFGLS
GLKGHRTGGSIHFIINNQIGFTTDPRFSRSSPYPSDVAKMVEAPIFHCNGDDPEAVTFAA
KVATEYRQKFGKPVVIDMLCYRRFGHNEGDEPAFTQPKMYQRIRKHPTALETYGKKLVEQ
GDVTQEQLDARKAEFRSMLESELDIAGGYKPNKADWLDGRWSGFKAVREDVDDPRRGRTG
VPVETLRDIATRITTPPPGFHLHRTIQRFFDNRAKAVETGVGIDWATAEALAFGSLLIEG
HRVRLSGQDVERGTFSQRHAVVIDQENEQRYTPLNSVREGQASLEVINSMLSEEAVLGFE
YGYSLAEPNSLVLWEAQFGDFANGAQVIIDQFISSGERKWLRMSGLVMLLPHGYEGQGPE
HSSARLERYLQMCAEDNMQVANCSTPSNYFHILRRQLKRDFRKPLILMTPKSLLRHKRAV
SKIEEIAEGSTFHRILWDDAEHDESGIKLTRDDKIRRVVLCSGKVYYDLYEEREKRGVND
VYLMRVEQLYPFPLKALANEMSRFRNAEVVWCQEEPKNMGSWTFVEPYLDWVLGQAGSAS
KRPRYVGRPASASTAVGLMSKHLAQLQAFLNEALAV
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atggcacgccaggacgcgaacgaagcgcttctccaaacctccttcctctacggcgccaac
gccgcctggatcgaggaattgcaggcagcctatgcccgcgacccgaactcggtcgatccc
gagtggcagcagttcttcaaggagctgggcgaggacgacgccctggtgaagaagaacgcc
gagggcgcctcctgggccaagcccaactggccggttccgctcaacggcgagatcgtctcc
gcgctcgacggcaattggggtgccctggaaagggctctcggcgagaagatccaggccaag
gcgcaaccgggaaagcccggcgactcggccaagggcgcggcgatcgttgccgccaccggc
gtctcggtcgagcaggccaccaaggactccgtgcgcgcgatcatgctgatccgcgcctac
cgcatgcgcggccacctgcacgccaagctcgatccgatcgggctcgccccgcgcggcgac
cacgaggagctgcatccgcagcattacggcttccaggagagcgactgggaccgcaagatc
ttcctcgacaacgtgctcggcatggaattctcgacgatccgcgagatcgtcggcatcctg
gagcgcacctactgccagacgctcggcgtcgagttcatgcacatctccgatcccgaggag
aaggcgtggctccaggagcgcatcgagggcaaggacaaggaaatctcgttcacgccggaa
gggcgccgcgcgatcctgaacaagctgatcgaggcggaaggcttcgagaaattcctcgat
ctcaagtacaccggcaccaagcgcttcggcctcgacggcggtgagtcgatggtcccggcc
ctggagcagatcatcaagcgcggcggcgcgctcggcgtcgaagagatcgtgctgggcatg
gcccaccgcggccgcctgaacgtgctcaccaacgtgatggccaagcccttccgcgcggtg
ttccacgagttcaagggcggctcggcctcacccgccgaggtcgagggctcgggcgacgtg
aagtaccatctcggcgcctcctccgaccgcgccttcgacgacaacaccgtccacctctcg
ctcaccgccaacccgtcccacctcgaaatcgtcgatccggtggtgctcggaaaggtgcgg
gccaagcaggaccagaaggccaagccgaatgtcgagcgccgcaaggtgctgccgctcctg
atccacggcgatgcggcctttgccggccagggcgtggtggcggagtgcttcgggctgtcc
ggcctgaagggccaccgcaccggcggctcgatccacttcatcatcaacaaccagatcggc
tttaccaccgacccgcgcttctcgcgctcctcgccctatccgtccgacgtggcgaagatg
gtggaagccccgatcttccactgcaacggcgatgaccccgaggccgtaaccttcgccgcg
aaggtcgcgaccgaatacagacagaagttcggcaagccggtcgtgatcgacatgctgtgc
tatcgccgcttcggccacaacgagggcgacgagccggccttcacccagccgaagatgtac
cagcggatccgcaagcatccgaccgcgctggagacctacggcaagaagctcgtcgagcag
ggcgacgtcacccaggagcagctcgacgcgcgcaaggcagagttccgttccatgctggag
agcgagctcgacatcgccggcggctacaagccgaacaaggccgattggctcgacgggcgc
tggtccggcttcaaggcggtacgcgaggacgtggacgatccccgccgcggccgcaccggc
gtgccggtcgagaccctgcgcgacatcgccacccggatcaccacgccgccgccgggcttc
cacctgcatcgcacgatccagcgcttcttcgacaaccgcgccaaggcggtcgagacgggc
gtcggcatcgattgggcgacggcggaagcgctggccttcggctcgctgctgatcgagggc
caccgcgtccggctctcgggccaggacgtcgagcgcggcaccttctcgcagcgtcacgcc
gtggtgatcgatcaggagaacgagcagcgctacacgccgctcaactccgtgcgcgagggg
caggcgagcctggaggtcatcaactcgatgctctccgaggaggcggtgctcggcttcgag
tacggctattccctggccgagccgaactccctggtgctgtgggaggcgcagttcggcgac
ttcgccaacggcgcacaggtcatcatcgaccagttcatctcatcgggcgagcgcaagtgg
ctgcgcatgtccggcctcgtgatgctgctgccccacggctacgagggccaggggccggag
cactcctccgcccgtctggagcgctatctccagatgtgcgccgaggacaacatgcaggtc
gccaactgctcgacgccctcgaactacttccacatcctgcgccgtcagttgaagcgcgac
ttccgcaagccgctgatcctgatgacgccgaaatcgctcctgcgccacaagcgggcggtt
tcgaagatcgaggagatcgcggagggctcgaccttccaccgcatcctgtgggacgacgcc
gagcacgacgagagcggcatcaagctcacccgcgacgacaagatccgccgcgtcgtgctg
tgctccggcaaggtttattacgacctctacgaggagcgggagaagcgcggcgtcaacgac
gtctacctgatgcgggtcgagcagctctatcccttcccgctcaaggcgctggccaacgag
atgagccgcttccgcaacgcggaggtggtgtggtgtcaggaagagcccaagaacatgggc
tcgtggaccttcgtcgagccctatctcgactgggtgctcggccaggccggctccgcctcg
aagcgcccgcgctacgtcggccgtccggcctcggcctcgaccgcggtcggcctgatgtcg
aagcacctcgcccagctccaagccttcctcaacgaggcgctggcggtctga

DBGET integrated database retrieval system