KEGG   Methylobacterium sp. DM1: C0214_16320Help
Entry
C0214_16320       CDS       T05461                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
metd  Methylobacterium sp. DM1
Pathway
metd00473  D-Alanine metabolism
metd00550  Peptidoglycan biosynthesis
metd01100  Metabolic pathways
metd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:metd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C0214_16320
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C0214_16320
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C0214_16320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:metd01011]
    C0214_16320
Enzymes [BR:metd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C0214_16320
Peptidoglycan biosynthesis and degradation proteins [BR:metd01011]
 Precursor biosynthesis
  Amino acid ligase
   C0214_16320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: AWI89686
UniProt: A0A2U8HXG8
LinkDB All DBs
Position
3454619..3455542
Genome map
AA seq 307 aa AA seqDB search
MSKHVAVLMGGWSSEREISLRSGNACAGALEGEGYRVTRVDVGPDIATVLTELKPDAALN
ALHGPAGEDGTIQGLLEILKIPYTHSGVLASALAMHKERAKTVMRAAGVSVPEGRVVNRH
DAAKSHPLTPPYVVKPIAEGSSMGVIIVREERSHPPQILASDEWVYGEEVLAETYVAGRE
LTCAVLGDRALGVTEIKPVSGEWYDFDAKYAGGGSIHVLPADLKLNIYQRVQELALTAHQ
ALGCRGVSRADLRYDDTPGGTGALVVLEVNTQPGMTQTSLVPEIAAHAGLSFGELVRWMV
EDASLNR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcacgtcgccgtcctgatggggggctggtcctccgagcgggaaatctcgctt
cgctccggcaatgcctgcgccggggcgctggaaggggaggggtatcgcgtcacccgcgtc
gatgtcggacccgacattgcgacggtgctaaccgagctcaagcccgacgcggccctcaac
gcgctccacggtccggcgggcgaggacggcacgatccagggcctcctggagatcctgaag
atcccctacacccattccggcgtgttggcctcggcgctcgcgatgcacaaagagcgtgcc
aaaacggtcatgcgcgcggccggtgtgagcgttccggagggccgggtcgttaaccgtcat
gatgcggcgaagtcacacccgttaacccctccctatgtcgtgaagccgatcgccgaggga
tcctccatgggggtcatcatcgtgcgtgaggaacgctcgcatccgccccagatcctggcc
tccgacgaatgggtctacggcgaggaagtgcttgcagagacttacgttgccggccgcgag
ctgacctgcgcggtgctgggcgaccgggcgctcggagtgaccgagatcaagcccgtctcg
ggggagtggtacgacttcgacgccaagtacgccggaggggggtcgatccacgtcctcccc
gccgatcttaaactaaatatttaccagcgtgtccaagagttggcgttaacggcgcatcaa
gcactgggatgccgtggcgtcagccgtgccgaccttcgctacgacgacacaccgggggga
accggtgctctcgtcgttctggaggtcaacacgcagccagggatgacccagacgagcctt
gtgccggagatcgcggcccacgcaggcctgagtttcggtgaactcgtccgatggatggtg
gaggacgcttctctcaaccgctga

DBGET integrated database retrieval system