KEGG   Methylobacterium sp. DM1: C0214_18750Help
Entry
C0214_18750       CDS       T05461                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
metd  Methylobacterium sp. DM1
Pathway
metd00010  Glycolysis / Gluconeogenesis
metd00620  Pyruvate metabolism
metd01100  Metabolic pathways
metd01110  Biosynthesis of secondary metabolites
metd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:metd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C0214_18750
   00620 Pyruvate metabolism
    C0214_18750
Enzymes [BR:metd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     C0214_18750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AWI90116
UniProt: A0A2U8HYP5
LinkDB All DBs
Position
3969709..3971232
Genome map
AA seq 507 aa AA seqDB search
MNKPEFLADAKTKSPFSARYDNFIGGQWAAPVGGRYFENTSPITGKVICEVARSDAQDID
KALDAAHAAKDSWGRTAPAERARILNKIADRMEENLDLIALAETWDNGKPIRETTAADIP
LAIDHWRYFASCVRAQEGAISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPAL
AAGNCVVLKPAEQTPASILVVMELIGDLLPPGVINVVNGFGLEAGKPLASSPRIAKIAFT
GETTTGRLIMQYASQNLIPVTLELGGKSPNIFFGDVANEDDDFFDKALEGFTMFALNQGE
VCTCPSRALVHESIYDRFIERAIKRVEAITQGSPLDPATMIGAQASSEQLEKILSYVDIG
KQEGAECLTGGARGTREGDLADGFYMQPTVFKGHNKMRIFQEEIFGPVLSVTTFKDDEEA
LSIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
THKMMLDHYQQTKNMLVSYSSKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcccgaattcctggccgacgccaagaccaagtcgccgttctcggcgcgttac
gacaacttcatcggcggccagtgggccgctcccgtcggcggccgctacttcgaaaatact
tcccctattaccggtaaggtgatctgcgaggtcgcccgttccgacgcgcaggacatcgac
aaggcgctcgacgccgcgcacgccgccaaggattcctggggccgcaccgcgccggccgag
cgcgcgcgcatcctcaacaagatcgccgaccggatggaggagaacctcgatctgatcgcg
ctcgccgagacctgggacaacggcaagccgatccgcgagaccaccgccgccgacatcccg
ctcgccatcgaccactggcgctacttcgcaagctgcgtgcgggcgcaggaaggcgcgatc
tccgagatcgaccacgacaccgtggcctaccacttccacgagccgctcggcgtcgtcggc
cagatcattccgtggaacttcccgatcctgatggcggtgtggaagctggcccccgcgctc
gccgccggcaactgcgtggtgctcaagcccgccgagcagaccccggcctcgatcctcgtg
gtcatggaactgatcggcgacctgctgccgcccggcgtgatcaacgtcgtcaacggcttc
ggcctggaggccggcaagccgctggcctcctcgccgcgcatcgccaagatcgcgttcacc
ggtgagacgaccaccggccgcctgatcatgcagtacgcctcgcagaacctgatcccggtg
acgctggagctgggcggcaagtcgccgaacatcttcttcggggacgtggccaacgaggat
gacgacttcttcgacaaggcgctcgaaggcttcaccatgttcgccctcaaccagggcgag
gtctgcacctgcccgagccgcgcgctggtgcacgagtcgatctacgaccgcttcatcgag
cgcgcgatcaagcgcgtggaggcgatcacgcagggctcgcccctcgacccggcgaccatg
atcggcgcccaggcctcctccgagcagctggagaagatcctcagctacgtcgatatcggc
aagcaggagggcgccgagtgcctcaccggcggcgcccgcggcacccgcgagggcgatctc
gccgacggcttctacatgcagccgacggtgttcaagggccacaacaagatgcggatcttc
caggaggagatcttcgggcccgtgctgtcggtgaccaccttcaaggacgacgaggaggcg
ctctccatcgccaacgacacgctctacggcctcggcgccggcgtgtggacccgcgacggc
acccgcgcctaccgcttcggtcgcgcgatccaggccggacgcgtctggacgaactgctat
cacgcctacccggcacacgcggccttcggcggctacaagcagtccggtatcggccgcgag
acccataagatgatgctcgatcactaccagcagaccaagaacatgctggtcagctattcc
tcgaagaagctcggcttcttctag

DBGET integrated database retrieval system