KEGG   Methylobacterium sp. DM1: C0214_21160Help
Entry
C0214_21160       CDS       T05461                                 

Definition
(GenBank) RNA-binding protein
  KO
K06178  23S rRNA pseudouridine2605 synthase [EC:5.4.99.22]
Organism
metd  Methylobacterium sp. DM1
Brite
KEGG Orthology (KO) [BR:metd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:metd03009]
    C0214_21160
Enzymes [BR:metd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.22  23S rRNA pseudouridine2605 synthase
     C0214_21160
Ribosome biogenesis [BR:metd03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    C0214_21160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S4 PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AWI90513
UniProt: A0A2U8HY07
LinkDB All DBs
Position
complement(4462569..4464503)
Genome map
AA seq 644 aa AA seqDB search
MTDNPDPSPAVPADQAAAPEGERIAKTIARAGIASRRDAEAMIEAGRVTLNGKVLTSPAI
NVTEADRITIDGEPLPVRERTRLWLLHKPRGVVTTARDPEGRQTVFDGLPDDLPRVVAIG
RLDINTEGLLLLTNDGGLAKVIAHPDTGWLRRYRVRAFGDITQADLDRLKKGVTVDGMEY
GPVEATLDRVQGDNLWLTLGLREGKNREVKRILEHLGLSVNRLIRLSFGPFQLGDLEVGL
VEEIRTKVLKEQLGKSLAEQAGVDFESPVREAIAPFGSPKATKAASPAGRSRPGARDEGR
DQERSEPRSGARGGAAGRPPRDPARPAAPRAAARPAPRAPSPTVWRADDETRPRASKVPR
RGMDPKTARAAAAERGRERVGAIQAAGERRVLVERLQPTPETPAPEPHRRVRFRREEERP
EPQERPRQERSYQERSYQERPQQERGYQERSRDDRREDRPRRDAPTGDARPRRHEAGAAG
SPERRGPPRERQTERQAEGRPFRERSEGRPARDRGEGAPRRERPAEGGAPERRGPPRDRP
RAAEGERPARPPRGEGGGFRKGPGAGPGGKPGFKGGARDGARGDFKGGPKGAPRGGPRGD
FKAGGRPGGGRPGGKPGGAGGRPGGGKPGPRGGGRPGRPPRGDA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaatccagacccctccccggccgtacccgcggaccaagccgccgcgcccgag
ggcgagcgcatcgccaagaccatcgcccgtgccggcatcgcctcccgccgcgacgccgag
gcgatgatcgaggccggccgcgtcaccctcaacggcaaggtcctgacctcgccggcgatc
aacgtcaccgaagccgaccgcatcacgatcgacggcgagcccctgcccgtccgcgagcgc
acccggttgtggctgctgcacaagccgcgcggcgtcgtcaccaccgcccgcgatccggaa
gggcgccagacggtgttcgacgggctgcccgacgacctgccgcgggtcgtcgccatcggc
cggctcgacatcaacaccgaggggctgctgctgctcaccaacgacggtgggctggccaag
gtgatcgcccatcccgataccggttggctgcgccgctaccgggtgcgcgccttcggcgac
atcacccaggccgatctcgaccggctcaagaagggtgtcaccgtcgacggcatggaatac
ggccccgtcgaggccaccctcgaccgggtccagggcgacaacctctggctcaccctcggc
ctgcgcgagggcaagaaccgcgaggtcaagcgcatcctcgaacatctcggcctctccgtg
aaccggctgatccggctctcgttcgggccgttccagctcggcgacctcgaagtcggtctg
gtcgaggagatccgcaccaaggtgctgaaggagcagctcggaaagagcctcgccgagcag
gccggcgtcgatttcgagagcccggtgcgcgaggccatcgccccgttcggaagccccaag
gcgacgaaggccgcttcacccgccgggcggagccgtccgggtgcccgcgacgagggccgc
gaccaggagcgttcggaaccgcgctcgggcgcccgcggcggagcggccggccgtccgccg
cgcgatcccgcacgccctgccgccccgcgcgccgccgcgcgccctgccccgcgggcaccc
tcgccgaccgtgtggcgggccgacgacgagacccgtccgcgcgcgagcaaggtgccgcgt
cggggcatggacccgaagactgcccgcgcggcggcggccgagcgcggccgcgagcgggtc
ggcgcgatccaggcggccggcgagcgccgggtgctggtcgagcggctccagccgacgccg
gagactcccgcccccgagccgcatcgccgggtccgcttccgtagggaggaggagcggccc
gagccgcaggagcgtccccgccaagagcgttcttaccaagagcgttcttaccaggagcgc
ccccagcaggagcgcggctaccaagaacgcagccgcgacgatcggcgcgaggatcggccg
cgccgagacgcgccgacaggcgatgcccgtccccgccgccacgaggctggggcggccggc
tcgcccgagcggcgtggcccgccgcgcgagcgccagaccgagcgccaagccgagggccgt
ccgttccgggagcggagcgagggccgtcccgcgcgcgaccgcggcgagggtgcgccccgc
cgggagcgtcccgccgaggggggcgcgccggagcgccgcggccccccgcgcgaccgaccc
cgcgccgccgagggcgagcggcccgcccgcccgccgcgcggcgagggcggcggtttccgc
aaggggccgggtgccggtccgggcggcaagcccggcttcaagggcggcgcccgcgacggg
gccagaggcgacttcaaaggcggtcccaagggagcgcccaggggcggcccgcggggagac
ttcaaggccggcggacgaccggggggcgggcgtcccggcggaaagcccggcggtgccggt
ggccgtcccggcggtggcaagccggggccgcgcggaggcggtcgtcccggccgtccgccg
cgcggcgacgcctag

DBGET integrated database retrieval system