KEGG   Methanothermobacter sp. EMTCatA1: tca_00906Help
Entry
tca_00906         CDS       T05328                                 

Gene name
ppcA
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mete  Methanothermobacter sp. EMTCatA1
Pathway
mete00620  Pyruvate metabolism
mete00680  Methane metabolism
mete00720  Carbon fixation pathways in prokaryotes
mete01100  Metabolic pathways
mete01120  Microbial metabolism in diverse environments
mete01200  Carbon metabolism
Module
mete_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mete00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    tca_00906 (ppcA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    tca_00906 (ppcA)
   00680 Methane metabolism
    tca_00906 (ppcA)
Enzymes [BR:mete01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     tca_00906 (ppcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAZ98974
UniProt: A0A223ZE11
LinkDB All DBs
Position
841443..842894
Genome map
AA seq 483 aa AA seqDB search
MKVPRCMSTQHPDNVNPPFFAEEPELGGEDEIREAYYVFSHLGCDEQMWDCEGKEVDNYV
VKKLLTKYQAFFRDHVLGEDLRLTLRVPNPTVERAEAKILLETLESIPRSYDTASLFYGM
DAAPVFEVILPMTSSSSCLNRIHSYYLDFVKGKERLQLADGVTVKEWIGEFRPDEINVIP
LFEDHEGMLNAAKITGEYLDGKDIQEQRVFLARSDPAMNYGMISATLLNRIALSDFRDLE
EESGVKLYPIIGMGSAPFRGNLRPDNVEDVTWEYRGAYTFTVQSSFKYDHEPSDVIRGIK
KLRSVKPGRAAEIERESVLEIISAYCREYRRQVMDLVDIINRVARYVPGRRKRKLHIGLF
GYSRSMGNVSLPRAITFTAALYSLGVPPELLGFNALSSGDLEFIEEVYPGLGRDLHDAAR
YANPESPFLSPEVKSSFEEYLEPEYDEGHMKTTEEIIRALRINRTANLQELILEAASQRK
FLG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttccaagatgcatgagtacacagcatccagacaacgttaacccgccgttcttt
gcagaagaacctgaactgggtggtgaagacgagataagggaggcatactacgtcttctca
cacctgggatgtgacgaacagatgtgggactgcgagggcaaggaagtggacaactacgtt
gtaaagaaactcctcacaaagtaccaggccttcttcagggaccatgtcctgggtgaggat
ctgaggctcaccctcagggtgcccaaccccacagttgagagggccgaggcaaagatactc
cttgagacccttgagagcatacccagatcctatgacaccgcaagcctcttctacgggatg
gacgcagccccggtcttcgaggtcatcctacccatgacctcatcaagcagctgcctcaac
cggatccacagctactacctggactttgtgaagggtaaggagaggctgcagctcgcagat
ggtgtgaccgtcaaggagtggataggtgaattccggcccgacgagatcaacgttatcccc
ctcttcgaggaccatgaggggatgctgaacgccgccaagatcacaggcgagtaccttgat
ggtaaggatatccaggagcagagggtcttccttgcaaggtcagaccccgccatgaactac
ggtatgatatcagccacactcctcaacaggatagccctctcagacttccgggaccttgag
gaagagtcaggagttaaactctaccccataataggtatgggctcagctcccttcaggggt
aacctccgccccgataatgtggaggacgttacctgggagtaccgtggcgcctacaccttc
actgtccagtcatccttcaagtacgaccatgaaccatcagatgtcatcaggggcataaag
aaactcaggtctgttaaaccgggcagggcagctgaaatcgagcgtgaaagtgtcctggag
ataatttcagcctactgcagggagtacaggaggcaggtcatggacctcgtggacatcata
aacagggttgcgaggtacgtgcccggcaggaggaagaggaagctccacatcggactcttc
ggatactccaggagcatgggaaacgtttcactcccaagggcaataaccttcacagcggcc
ctctactcgctgggggttcccccggagctgctcgggttcaacgcgctatcatcaggtgac
cttgaattcattgaggaggtctacccgggtcttggaagggacctccatgacgctgcaagg
tacgccaaccctgaatcaccattcctcagccctgaggttaaatcatcctttgaggagtac
cttgaacctgagtatgatgagggacacatgaagaccacagaggagatcataagggccctc
agaatcaacaggacagccaacctccaggagctcatccttgaggctgcaagccagaggaag
ttcctcggctga

DBGET integrated database retrieval system