KEGG   Methanothermobacter sp. EMTCatA1: tca_01685Help
Entry
tca_01685         CDS       T05328                                 

Gene name
porA
Definition
(GenBank) Pyruvate synthase subunit PorA
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mete  Methanothermobacter sp. EMTCatA1
Pathway
mete00010  Glycolysis / Gluconeogenesis
mete00020  Citrate cycle (TCA cycle)
mete00620  Pyruvate metabolism
mete00633  Nitrotoluene degradation
mete00640  Propanoate metabolism
mete00650  Butanoate metabolism
mete00680  Methane metabolism
mete00720  Carbon fixation pathways in prokaryotes
mete01100  Metabolic pathways
mete01110  Biosynthesis of secondary metabolites
mete01120  Microbial metabolism in diverse environments
mete01130  Biosynthesis of antibiotics
mete01200  Carbon metabolism
Module
mete_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mete_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mete00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    tca_01685 (porA)
   00020 Citrate cycle (TCA cycle)
    tca_01685 (porA)
   00620 Pyruvate metabolism
    tca_01685 (porA)
   00640 Propanoate metabolism
    tca_01685 (porA)
   00650 Butanoate metabolism
    tca_01685 (porA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    tca_01685 (porA)
   00680 Methane metabolism
    tca_01685 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    tca_01685 (porA)
Enzymes [BR:mete01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     tca_01685 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: BAZ99728
UniProt: A0A223Z3Z9
LinkDB All DBs
Position
complement(1558993..1560144)
Genome map
AA seq 383 aa AA seqDB search
MVLKVISANQAVAEAAKLAKPKVIPVYPITPQTSISEYLAKFVADGELKAEYIRVESEHS
AMSACVGASGAGVRVFTATSSQGLALMHEIVYAAAGLRNPIVMANANRALSAPLSIWNDQ
QDSIAERDSGWMQIYVENGQEALDSVLLSYRVSEDRDVLLPSMVCLDGFILTHTVEPVDI
PSQENVDSFLPEFQPRVILDPDEPMSLGTFTDPDYYMEARYEVEKAMERSRKIIERACRE
FSEMFGRDYGFVEEYRCEDAEIILVAMGSVCSTLREVIDELRDKGKAVGLLKVRVHRPFP
AEEIKRAVRNASKVAVLDKNITFSVGGALYTEISALLRDRDVYGFIVGLGGRDITPAHIE
EIVKRTETPERSVTWIGLKEESE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggttcttaaggttatatcagcaaatcaggccgttgcagaagcagcaaagcttgcaaaa
ccaaaggttattcctgtttaccccataacaccccagacttcaatttcagagtaccttgca
aaattcgtggctgatggagaactcaaagcagaatatataagggttgaatcagagcacagt
gcaatgagcgcatgcgtgggcgcttcaggagctggagtgcgggttttcaccgcgacctcc
tcccagggactggcgctgatgcatgagatagtttatgctgcagcaggtctcaggaatccc
atcgtcatggcaaatgcaaaccgcgccctctccgcacccctcagcatatggaatgaccag
caggattcaatagcagagcgggactcagggtggatgcagatatacgttgaaaatggacag
gaagccctcgattctgtccttctatcctacagggtatcagaggacagggatgttctgctg
cccagtatggtgtgcctcgatgggttcatcctgacccacaccgttgaacccgtggacatc
ccctcacaggagaatgttgacagcttcctccctgaattccagccccgggtcatccttgac
cctgatgagcccatgtcactgggtaccttcacagaccctgactattacatggaggcccgc
tatgaggtcgagaaggccatggagcgctcaaggaagatcattgaaagggcatgcagggaa
ttcagtgaaatgttcggccgggactacggctttgttgaggaatatcgctgtgaagatgca
gaaataatcctggtggccatgggttcagtctgtagcaccttaagggaggtcatcgatgaa
ctcagggataagggaaaggccgttggactacttaaggtcagggtgcacaggcccttccct
gctgaggagattaaaagggctgttaggaacgccagtaaagtagcggtcctcgataagaac
ataacattcagtgttggcggagccctttacacagagataagtgccctgctacgtgacagg
gatgtttatggattcattgtgggcctcggtggaagagacataacacccgcacacatcgag
gaaatagttaaaaggacggaaacccctgaaagaagcgtcacctggatcggtctcaaggag
gaatcagaatga

DBGET integrated database retrieval system