KEGG   Methanobacterium sp. MB1: MBMB1_0906Help
Entry
MBMB1_0906        CDS       T02957                                 

Gene name
GAD2
Definition
(GenBank) Glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
meth  Methanobacterium sp. MB1
Pathway
meth00250  Alanine, aspartate and glutamate metabolism
meth00410  beta-Alanine metabolism
meth00430  Taurine and hypotaurine metabolism
meth00650  Butanoate metabolism
meth01100  Metabolic pathways
meth01110  Biosynthesis of secondary metabolites
meth01120  Microbial metabolism in diverse environments
meth02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:meth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MBMB1_0906 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MBMB1_0906 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MBMB1_0906 (GAD2)
   00430 Taurine and hypotaurine metabolism
    MBMB1_0906 (GAD2)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MBMB1_0906 (GAD2)
Enzymes [BR:meth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MBMB1_0906 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CDG65008
UniProt: U6EDB6
LinkDB All DBs
Position
883390..884784
Genome map
AA seq 464 aa AA seqDB search
MLSGKKDLKKLDKSQREHNTATTAYGTRYFEKSIPKYEIPLDGMPADAAYQLIHDELNLD
GNPVLNLASFVTTWMEPQADKLIMESVDKNYVDADEYPQTQKIEERVVNILARLFNSPDD
CHSIGTATIGSSEAIMLALLAHKWTWRENRKAEGKPTDKPNIVMGADVHTVWEKFAKYFD
VELKLIPIKDDLYTITAEDVAKEVDENTIAVGAVIGTTFTGQMDPIKEINDVLMDIKKEK
GWNIPIHVDGASGGFIAPFIHPDMEWDFRLEQVRSINVSGHKYGLVYPGVGWVVFKDKSD
VPEDLVFNINYLGGSMSNYSLNFSKASNTIIAQYYNLIRLGFNGYKAVIDNMIENTRYMA
DKLEETGRFEVLNPKILFPLVTVKLKDSDFTVFQLSDKLREHGWIVPAYTLPANADDIAV
LRMVIKENFGRDMVNAFIDDIKTCCKNLESEEEKIKKEDPSLLY
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatctggaaaaaaagatctcaaaaaattggacaaatcacaaagagaacataatact
gcaaccactgcttatggaaccaggtattttgaaaagagcatacctaaatatgagatacca
cttgatggtatgcctgccgatgctgcttatcaattaatccatgatgaattaaatttagac
ggtaatcctgtcttgaatctggcaagctttgtaaccacctggatggagccacaggcagat
aagttgattatggaatctgtggataaaaactacgtggacgctgatgagtaccctcagact
cagaagatagaagaaagagtggttaacatactggccagactgttcaactcaccagatgac
tgccattccattggtactgccaccattggatcatcagaggctataatgctggccctcctt
gcacataaatggacatggagggagaacagaaaagctgaagggaaacctacagataaaccc
aacatagtcatgggtgcagacgttcacacagtatgggagaaatttgccaaatatttcgat
gtagaattaaagctcatccccataaaggatgatctgtacaccataactgcagaggatgtt
gccaaagaagttgatgaaaacaccatagcagtaggggcagttattggaaccacttttact
ggacaaatggatcctattaaagagataaatgatgttttaatggacattaaaaaagaaaaa
ggatggaacataccaatccatgtagatggtgccagtggtggatttatagctccattcata
catccagatatggaatgggatttcagactcgaacaggtaagatccataaatgtatccgga
cacaaatacggcctggtttatcctggtgttggctgggtggtatttaaagacaaatcagat
gtacctgaagacttagtatttaacatcaattacctgggtggtagtatgagtaattattcc
cttaacttctccaaggcgagcaacactatcatcgcccagtactacaacctcatccgctta
ggattcaatggctataaggcagtcattgataacatgattgaaaatacaaggtacatggca
gataaactagaagaaacaggtagatttgaagttctaaatccaaagatcttattccctctg
gtcacagttaaattgaaagactcagacttcacagtcttccaactttcagataaactccga
gaacatggttggatagtaccggcctatacactaccagcaaatgctgatgatatagctgtc
ctaaggatggtaatcaaggagaattttggaagagatatggtaaatgctttcattgatgac
ataaaaacatgttgtaagaacctggaatcagaggaagaaaagattaaaaaggaagatcca
tctctgctctactaa

DBGET integrated database retrieval system