KEGG   Methanobacterium sp. MB1: MBMB1_1540Help
Entry
MBMB1_1540        CDS       T02957                                 

Gene name
porA
Definition
(GenBank) Pyruvate synthase subunit PorA
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
meth  Methanobacterium sp. MB1
Pathway
meth00010  Glycolysis / Gluconeogenesis
meth00020  Citrate cycle (TCA cycle)
meth00620  Pyruvate metabolism
meth00633  Nitrotoluene degradation
meth00640  Propanoate metabolism
meth00650  Butanoate metabolism
meth00680  Methane metabolism
meth00720  Carbon fixation pathways in prokaryotes
meth01100  Metabolic pathways
meth01110  Biosynthesis of secondary metabolites
meth01120  Microbial metabolism in diverse environments
meth01130  Biosynthesis of antibiotics
meth01200  Carbon metabolism
Module
meth_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
meth_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:meth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MBMB1_1540 (porA)
   00020 Citrate cycle (TCA cycle)
    MBMB1_1540 (porA)
   00620 Pyruvate metabolism
    MBMB1_1540 (porA)
   00640 Propanoate metabolism
    MBMB1_1540 (porA)
   00650 Butanoate metabolism
    MBMB1_1540 (porA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MBMB1_1540 (porA)
   00680 Methane metabolism
    MBMB1_1540 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MBMB1_1540 (porA)
Enzymes [BR:meth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MBMB1_1540 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C NAPRTase TPP_enzyme_N Ribul_P_3_epim
Motif
Other DBs
NCBI-ProteinID: CDG65634
UniProt: U6EEW1
LinkDB All DBs
Position
1526321..1527469
Genome map
AA seq 382 aa AA seqDB search
MVQKVYSSNRAVAEAVKLAKPNVVPVYPITPQTTISEYLAQFVADGDLKAEYIRVESEHS
AISAALGASGAGVRVFTATSSQGLALMHEILFATAGMRSPIVLVDANRALSAPLSIWNDQ
QDSISERDSGWMQIYAENAQEALDAVLIAYRVAEDPEVLLPCMVCIDGYFLTHTVEPLDV
PSQEEVDEFLPPYKPYAFLDPEKPMSIGTFTDPEYYMEARYAVEAAMEKSKNVFRKANQE
FKEIFGREYDLIETYRCEDAEIIMVAMGSLCGTIKDVIDELREEGEKVGLLKIRVFRPFP
TEEIKEVLEKASKVAVIDKNISFGMGGVLYNNIRATTNANAHGFIAGLGGRDITPSFIRE
IIEKTKNPTGEVEWIGLKKEEL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaaaagtttattcttctaaccgagccgtggccgaagccgttaaactggccaaa
cccaacgtagttcctgtttatcccataacaccccaaacaaccatttccgaatatttagcc
cagtttgtggccgacggggatctaaaagcagaatacattcgtgtggaatcagaacacagt
gctataagtgctgctttaggtgcttctggagctggtgttcgagttttcactgcaacctca
tcccagggtctggccctgatgcacgaaatactatttgctaccgctggtatgcgaagtccc
attgtactggtggatgcaaaccgcgcactatctgcaccactgagtatatggaacgatcag
caagattcaatatctgaacgtgactcaggatggatgcaaatatatgcagaaaacgcacag
gaagccctggacgctgttttaatagcttaccgcgtagctgaagatccagaagttttactg
ccctgtatggtttgtattgacggatacttcttaacccacactgtggaaccactggatgta
cccagccaggaagaggtggacgagttcttaccaccctacaagccctatgctttcctggac
ccggaaaaacccatgtccattggaaccttcactgacccagaatactacatggaagcccgt
tacgctgtagaagcagccatggaaaaatccaaaaatgtatttagaaaggcgaatcaggaa
tttaaagaaatattcggccgagaatatgacctgattgaaacttatcggtgtgaagatgct
gagatcataatggtagccatgggctcactctgtggaaccataaaagatgttatcgatgag
ctaagagaagaaggagaaaaagtaggactcctaaaaatcagggtgttccgacccttccct
actgaagaaataaaagaagtcctggaaaaagcttccaaagtagcagtgattgataaaaat
atctcatttggaatgggaggagtgctctacaacaatattagagccaccaccaatgccaat
gcccatggatttatagctggactaggaggaagagatataaccccttcattcatcagggaa
attattgaaaaaactaaaaaccccaccggagaggtggaatggatcggactcaaaaaggag
gaactctaa

DBGET integrated database retrieval system