KEGG   Methylobacterium sp. 17Sr1-43: DK427_00960
Entry
DK427_00960       CDS       T05919                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K13584  two-component system, cell cycle response regulator CtrA
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_00960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:meti02022]
    DK427_00960
Two-component system [BR:meti02022]
 Cell cycle family
  CckA-CtrA/CpdR (cell cycle control)
   DK427_00960
SSDB
Motif
Pfam: Response_reg Trans_reg_C
Other DBs
NCBI-ProteinID: AWN34487
UniProt: A0A2U8VLP2
LinkDB
Position
230217..230918
AA seq 233 aa
MRVLLIEDDSATAQSIELMLKSENFNTYTTDLGEEGVDLGKLYDYDIILLDLNLPDMSGY
EVLRSLRVAKVKTPILILSGMAGIEDKVKGLGFGADDYLTKPFHKDELVARIHAIVRRSK
GHAQSVITTGDLVVNLDQKTVEVGGARVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYG
GMDEPELKIIDVFICKLRKKLANASQGRNYIETVWGRGYVLREPNEVEERIAV
NT seq 702 nt   +upstreamnt  +downstreamnt
atgcgggtacttctgatcgaggacgacagcgccacggcgcagagcatcgagctgatgctc
aagtccgagaacttcaacacctacaccaccgatctcggtgaggagggtgtcgatctcggc
aagctctacgattacgacatcatcctgctcgacctgaacctgcccgacatgtcgggctac
gaggttctccggtcgcttcgcgtcgccaaggtgaagacgccgatcctgatcctgtctggc
atggcgggcatcgaggacaaggtgaagggcctcggcttcggcgccgacgactacctgacc
aagcccttccacaaggacgagctcgtcgcccgcatccacgcgatcgtgcgccgctcgaag
ggccacgcccagtcggtgatcaccacgggcgacctcgtggtgaacctcgaccagaagacc
gtcgaggtcggcggcgcccgcgtgcacctcaccggcaaggagtaccagatgctggaactc
ctctcgctccggaagggcacgacgctgaccaaggagatgttcctcaaccacctctacggg
ggcatggacgagcccgagctgaagatcatcgacgtgttcatctgcaagcttcgcaagaag
ctcgccaacgccagccagggccgcaactatatcgagaccgtctggggccgaggctacgtg
ctgcgcgagccgaacgaggtcgaggagcgcatcgcggtctga

DBGET integrated database retrieval system