KEGG   Methylobacterium sp. 17Sr1-43: DK427_01655
Entry
DK427_01655       CDS       T05919                                 

Definition
(GenBank) invasion-associated locus B family protein
Organism
meti  Methylobacterium sp. 17Sr1-43
SSDB
Motif
Pfam: IalB
Other DBs
NCBI-ProteinID: AWN38781
UniProt: A0A2U8VZI7
LinkDB
Position
complement(382549..382971)
AA seq 140 aa
MVRKTFDDWQLRCETPAGAKAEQCALVQYLAAEDRPNLTLVVIVLKTADNRGYLLRVVAP
LGVLLPSGLGLKIDQTDIGRAGFVRCLTTGCVAEVVMDEGLIRQFRNGGQATFIVFQTPE
EGVGIPLSMKGFGTGFDSLK
NT seq 423 nt   +upstreamnt  +downstreamnt
atggtgcgcaagaccttcgacgactggcaactgcgctgcgagacgcccgccggcgccaag
gcggagcaatgcgcgctggtgcagtacctcgccgccgaggaccggccgaacctcaccctc
gtggtcatcgtgctcaagaccgccgacaaccgcggctacctgctgcgcgtggtggccccg
ctcggcgtgcttctgccctcgggcctcggcctcaagattgatcagaccgatatcggccgc
gccggcttcgtgcgctgcctcaccacgggctgcgtcgccgaggtggtgatggacgagggc
ctgatccgccagttcaggaacggcggccaggcgaccttcatcgtgttccagacgcccgag
gagggcgtgggcattcccctgtcgatgaaggggttcggcaccggcttcgacagcctcaaa
tag

DBGET integrated database retrieval system