KEGG   Methylobacterium sp. 17Sr1-43: DK427_01670
Entry
DK427_01670       CDS       T05919                                 

Definition
(GenBank) hypothetical protein
Organism
meti  Methylobacterium sp. 17Sr1-43
SSDB
Motif
Pfam: TadE
Other DBs
NCBI-ProteinID: AWN34600
UniProt: A0A2U8VM32
LinkDB
Position
384716..385282
AA seq 188 aa
MLATFGRCRSGVTAIEFAVAGPVLFIAMLEILQGGVFLYSSAAVERATVAAARAIQVGSL
DSTKAGTAANFREKVLCPALMPGMTCGNVVTNLQTANMTGAGYGAFVKPDLSALVAVTMD
NNQTSYCPSAPKVYQYLQVFYAMPLFSPLWRSTVGQRWSVNGQTVVFVRSAAAFRNEPYT
GSSFTTSC
NT seq 567 nt   +upstreamnt  +downstreamnt
atgctcgcgaccttcgggcgctgccggtccggggtcacggcgatcgagtttgcggtcgcc
ggcccggtcctgttcatcgcgatgctggagatcctgcagggcggggtgttcctgtacagc
tcggccgctgtcgagcgggcgaccgtcgcggcggcccgggccatccaggtcgggagcctc
gactcgactaaggccggcacggccgcgaacttccgcgagaaggtcctgtgcccggccctg
atgccgggcatgacgtgcggcaacgtcgtcaccaacctccagactgccaacatgaccggg
gcaggctacggcgccttcgtcaagccggacctgagcgcgctcgtcgccgtcacgatggac
aacaaccagacgagctactgcccgagcgcgccgaaggtctaccagtaccttcaggtcttc
tacgcgatgccgctgttcagcccgctctggcgcagcactgtcggccagcgctggagcgtc
aacggccagaccgtcgtgttcgtgcgctcagccgcggcgttccgcaacgaaccctacacc
ggcagcagcttcaccacgagttgctga

DBGET integrated database retrieval system