KEGG   Methylobacterium sp. 17Sr1-43: DK427_01690Help
Entry
DK427_01690       CDS       T05919                                 

Definition
(GenBank) two-component sensor histidine kinase
  KO
K15011  two-component system, sensor histidine kinase RegB [EC:2.7.13.3]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_01690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:meti01001]
    DK427_01690
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:meti02022]
    DK427_01690
Enzymes [BR:meti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     DK427_01690
Protein kinases [BR:meti01001]
 Histidine kinases
  Other
   DK427_01690
Two-component system [BR:meti02022]
 Other families
  RegB-RegA (redox response)
   DK427_01690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_3 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AWN34604
UniProt: A0A2U8VLW4
LinkDB All DBs
Position
388890..390284
Genome map
AA seq 464 aa AA seqDB search
MPDSDPSRLLRDARHLRLDTFVRLRWLAIAGQSAAVVGAQFGLGLSLPFGWCFLAIAASS
WLNLGLRIRFPASYRLNDDAAALLLAFDIVQLAALLFLTGGLQNPFSLLFLAPVLISATA
LPPERTLALGLLAVGLATLLALVHRPLPWFADGRIELPFLYVSGVWTAILLGTAFTGVYA
WRVSEETRQLAQALAATELVLAREQHLSQLDGLAAAAAHELGTPLGTILVVTKELVRQLG
PAATPAVREDLDLLREQVDRCRGILGKLTSLGSDGDGGGFLETVTLGQIVEELAAPQRAL
GVVLDVSGRGEGPEPACRRNPGVMYGLANILDNAIDFSEARVTLEARWTLDRVSLEIRDD
GPGFPSEVLLRAGEPYITTRSPERRDDDDAWNRGGLGLGLFIAKTLIERSGAQITLSNAA
GPGNHGAVVRISWARHIFERGAAPRHSPELPRPAPLPTGDAAPI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacagcgatccgtcccgcctcctgcgcgatgcgcgccacctgcgcctggacacc
ttcgtgcggctgcgctggctcgccatcgcgggccagagcgcggcggtggtgggcgcgcag
ttcgggctgggcctgtccctgcccttcggctggtgcttcctggcgatcgccgcctcgtcc
tggctgaatctcggcctacgcatccgcttcccggcgagctaccgactcaacgacgacgcc
gccgcgctgctgctggccttcgacatcgtccagctcgcggcgctgctcttcctcaccggc
gggctgcagaacccgttctcgctcctgttcctggcccccgtgctgatctcggcgaccgcg
ctgccgccggagcggacgctggcgctggggctcctcgcggtcgggctcgccacgctgctg
gccctagtgcaccggccgctgccctggttcgctgacgggcggatcgagctgccgttcctc
tacgtctcgggggtctggaccgcgatcctgctcggcaccgccttcacgggcgtctacgcc
tggcgggtctcggaggagacgcgtcagctcgcccaggcgctggcggccaccgagctggtg
ctcgcccgcgagcagcatctctcgcagctcgacggtctggcggcagccgccgcgcacgag
ctgggcacgccgctcggcaccatcctggtggtgacgaaggaactggtgcgccagctcgga
ccggcggcgacgccggctgtgcgcgaggatctcgatctcctgcgcgaacaggtcgaccgc
tgccgcggcatcctgggcaagctcacctcgctgggatcggacggcgacggcggcggcttc
ctggagactgtgacgctgggccagatcgtcgaggaactcgccgccccgcagcgcgcgctc
ggcgtcgtgctcgacgtcagcggccgtggcgaggggcccgagcccgcctgccggcgcaat
cccggcgtgatgtacgggctcgccaacatcctcgacaacgcgatcgacttctcggaggcg
cgcgtgacgctggaggcgcgctggacgctcgaccgggtctcgctggagatccgcgacgac
gggccgggcttcccctccgaggtgctgctgcgggcgggcgagccctacatcaccacccgc
agcccggagcggcgcgacgacgacgacgcctggaaccgcggcgggctcggcctcggcctg
ttcatcgccaagacactgatcgagcgctcgggcgcgcagatcaccctgtcgaacgccgcc
gggcccggcaaccacggcgcggtggtgcggatctcctgggcgcgccacatcttcgagcgc
ggcgccgcgccccggcactcgcccgaacttccgcgccccgcacccctcccgaccggtgac
gccgcacctatataa

DBGET integrated database retrieval system