KEGG   Methylobacterium sp. 17Sr1-43: DK427_01695
Entry
DK427_01695       CDS       T05919                                 

Definition
(GenBank) two-component system response regulator
  KO
K15012  two-component system, response regulator RegA
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_01695
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:meti02022]
    DK427_01695
Two-component system [BR:meti02022]
 Other families
  RegB-RegA (redox response)
   DK427_01695
SSDB
Motif
Pfam: Response_reg HTH_30 HTH_8 HTH_23 HTH_28 HTH_29 Glyco_trans_4_2 HTH_Tnp_ISL3 HTH_38 OKR_DC_1_N Phage_NinH
Other DBs
NCBI-ProteinID: AWN34605
UniProt: A0A2U8VLS5
LinkDB
Position
390323..390907
AA seq 194 aa
MLTQSGTATPGSETDPLAAFTDRSLLIVDDDKPFSTRLARAMESRGYEVQVAESVAEGVS
AVESRAPAFAVIDMRLGDGNGLDVIARLKEQRPEARGVILTGYGNIATAVNAVKLGAFDY
LAKPADADEIHGTLMAQPGERADPPENPMSADRVRWEHIQRVYELCGRNVSETARRLNMH
RRTLQRILAKRAPR
NT seq 585 nt   +upstreamnt  +downstreamnt
atgctgacgcagagcggaaccgctacgccaggatccgagaccgatccactggccgccttc
accgaccgtagcctcctgatcgtggacgacgacaagcccttctcgacgcgcctcgcccgc
gcgatggagagccggggctacgaggtgcaggtggccgagagcgtggccgagggcgtctcg
gccgtggagagccgcgcgccggccttcgcggtgatcgacatgcgcctcggcgacggcaac
gggctcgacgtgatcgcccgcttgaaggagcagcgcccggaggcccgcggcgtgatcctc
accggctacggcaacatcgcgaccgcggtgaacgccgtgaagctcggcgccttcgactac
ctcgcaaaaccggcggacgcggacgagatccacggcacgctgatggcccagcccggcgag
cgcgccgacccgccggagaacccgatgtccgccgaccgggtgcgctgggagcatatccag
cgcgtctacgagctctgcgggcgcaatgtgagcgagacggcgcggcgcctcaacatgcac
cgccgcacgctccagcggatcctggccaagcgcgcgccgcgctga

DBGET integrated database retrieval system