KEGG   Methylobacterium sp. 17Sr1-43: DK427_01920
Entry
DK427_01920       CDS       T05919                                 

Gene name
gloB
Definition
(GenBank) hydroxyacylglutathione hydrolase
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti00620  Pyruvate metabolism
meti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:meti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DK427_01920 (gloB)
Enzymes [BR:meti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     DK427_01920 (gloB)
SSDB
Motif
Pfam: HAGH_C Lactamase_B Lactamase_B_2 NAD_binding_10
Other DBs
NCBI-ProteinID: AWN34645
UniProt: A0A2U8VLV4
LinkDB
Position
438872..439642
AA seq 256 aa
MSAAETRTFLCRSDNIGVLIRDPRTGACAAIDVPEAAPVLRALDETGWRLTDILVTHRHG
DHIEGIPEVRRATGARLTAPEKAREAVPDADAYVREGDRVRVGDLEAEVWETPGHCLDHV
AYWFSGAEIVFAGDTLFTLGCGRVMESPPETLWRSLQRFEVLPDATQVFSGHDYVISNAR
FALAAEPDNAALQARAAEAERAKAEGRFLVPSTMGVERDTNPFLRAREPALARAVDLPSG
DSTAVFVALRAWKNRF
NT seq 771 nt   +upstreamnt  +downstreamnt
atgagcgccgccgagacccgcaccttcctctgccgcagcgacaatatcggggtgctgatc
cgcgatccccgcacgggcgcctgcgcggcgatcgacgtgccggaggcggcacccgtgctg
cgcgccctcgacgagaccggctggcggctcaccgacatcctcgtcacccaccggcacggc
gaccacatcgagggcatcccggaggtgcgccgcgccaccggcgcccgtctcaccgccccg
gagaaggcgcgcgaggccgtgcccgacgccgacgcctacgtgcgggagggcgaccgggtc
cgggtgggcgatctggaggcggaggtctgggagacgccgggccactgcctcgaccacgtc
gcctactggttctcgggggccgagatcgtgttcgcgggcgacaccctgttcaccctcggc
tgcggccgcgtgatggagagcccacccgagaccctgtggcgctcgctccagcgcttcgag
gtgctgcccgacgccacgcaggtgttcagcggtcacgactacgtaatctccaacgcccgc
ttcgcgctcgccgcggagcccgacaacgcggccctgcaggcccgcgcggccgaagccgag
cgggcgaaggcggaggggcgcttcctcgtgccctcgaccatgggcgttgaacgggacacc
aaccccttccttcgggcgcgcgagccggcgctcgcgcgcgccgtcgatctgccttcaggc
gattcgaccgcggtcttcgtcgcactgcgggcgtggaagaaccgcttctag

DBGET integrated database retrieval system