KEGG   Methylobacterium sp. 17Sr1-43: DK427_01960
Entry
DK427_01960       CDS       T05919                                 

Definition
(GenBank) hypothetical protein
Organism
meti  Methylobacterium sp. 17Sr1-43
SSDB
Motif
Pfam: DUF4702
Other DBs
NCBI-ProteinID: AWN34653
UniProt: A0A2U8VM24
LinkDB
Position
448933..449139
AA seq 68 aa
MFSTSKVGRLAVPALASGPASAAGDVEPLQWFSGTLSSASFLAALCLVLIAIFYSTRWLI
HLLLRRIR
NT seq 207 nt   +upstreamnt  +downstreamnt
ttgttctcgacctctaaggtcggtcgtctcgcggtgcccgctctcgcgagcgggcccgcc
tccgcggcgggcgatgtcgaaccgctgcaatggttctctgggaccctatcctcggcgtcg
ttcctggcggcgctctgcctcgtgttgatcgccatcttctattcgacacgctggctgatc
cacctccttctccgccgcatcaggtag

DBGET integrated database retrieval system