KEGG   Methylobacterium sp. 17Sr1-43: DK427_01980
Entry
DK427_01980       CDS       T05919                                 

Definition
(GenBank) hypothetical protein
Organism
meti  Methylobacterium sp. 17Sr1-43
SSDB
Other DBs
NCBI-ProteinID: AWN38785
UniProt: A0A2U8VYE8
LinkDB
Position
452430..452780
AA seq 116 aa
MSAPPVTPDGRYIVVRGRLWRRADPGLTEAARARAVAALMTARRAVRVAKAAERAGDPGA
FEALRAARAAVQGAKEALGERGPVWWDDGAPDETRRLARNTRYATWFAGLAGAEEG
NT seq 351 nt   +upstreamnt  +downstreamnt
gtgagcgcgcctccggtcacgccggacgggcgctacatcgtggtgcgggggcggctgtgg
cggcgcgccgatcccgggctgacggaggccgcgcgggcgcgggcggtcgcggcgctgatg
acggcgcggcgggccgtgcgcgtcgccaaggccgcggagcgggccggtgacccgggagcg
ttcgaagcgctccgcgcggcgcgggccgccgtgcagggggccaaggaggcgctcggcgag
cgcggcccggtctggtgggacgacggcgccccggacgagacccggcggctcgcgcgcaac
acgcgctacgccacgtggttcgccggcctcgcgggcgcggaggaagggtga

DBGET integrated database retrieval system