KEGG   Methylobacterium sp. 17Sr1-43: DK427_02060
Entry
DK427_02060       CDS       T05919                                 

Definition
(GenBank) heat-shock protein
  KO
K04080  molecular chaperone IbpA
Organism
meti  Methylobacterium sp. 17Sr1-43
Brite
KEGG Orthology (KO) [BR:meti00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:meti03110]
    DK427_02060
Chaperones and folding catalysts [BR:meti03110]
 Heat shock proteins
  HSP20
   DK427_02060
SSDB
Motif
Pfam: HSP20 ArsA_HSP20
Other DBs
NCBI-ProteinID: AWN34668
UniProt: A0A2U8VMH0
LinkDB
Position
complement(466800..467336)
AA seq 178 aa
MRTYDFAPLYRSTVGFDRLFSMLDQAARVEPSTQWPPYDIEKVADDAYRITMAVAGFSRD
EIELTQHDTALIVTGQKADKDGERAYLHRGIAARAFRQTFSLADHVRVTGASLEHGLLTV
ELKREVPEALKPRRIAIGGTQAALGQDNAPAQVEAPDKVEVSGKVEVSGKVEAPARAA
NT seq 537 nt   +upstreamnt  +downstreamnt
atgaggacctacgacttcgcgccgctctatcgttccacggtcggcttcgaccgcctgttc
tcgatgctcgaccaagccgcccgggtcgaaccctcgacccagtggccgccctacgacatc
gagaaggtcgccgacgacgcctaccgcatcaccatggcggtcgccggcttctcgcgggac
gagatcgagctgacgcagcacgacaccgcgctcatcgtcaccggccagaaagccgacaag
gacggggagcgcgcctacctgcaccgcggcatcgcggcccgcgccttccgccagaccttc
agtctcgccgaccacgtgcgggttacgggcgccagcctggagcacggcctgctgaccgtg
gagctcaagcgcgaggtgccggaggctctgaagccccgccgcatcgccatcggcggcacg
caggcggccctcgggcaggacaacgcgccggcccaggtcgaggcgcctgacaaagtcgag
gtgtctggcaaagtcgaggtgtctggcaaagtcgaggcgcccgccagggccgcctga

DBGET integrated database retrieval system