KEGG   Methylobacterium sp. 17Sr1-43: DK427_02130
Entry
DK427_02130       CDS       T05919                                 

Definition
(GenBank) 3-phosphoglycerate dehydrogenase
  KO
K16843  (S)-sulfolactate dehydrogenase [EC:1.1.1.310]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti00270  Cysteine and methionine metabolism
meti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:meti00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DK427_02130
Enzymes [BR:meti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.310  (S)-sulfolactate dehydrogenase
     DK427_02130
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh
Other DBs
NCBI-ProteinID: AWN34681
UniProt: A0A2U8VMM8
LinkDB
Position
complement(480741..481697)
AA seq 318 aa
MPEGSTPKVVISEFMDEAAIAAELQGFDTLYDPGLVDRPDALAAALKGADALIVRNRTQV
RGALLEGAPDLKVVGRLGVGLDNIDVAACRARNIAVYPATGANDGSVAEYVIGTAMLLLR
GAYGATAAVAAGTWPRNALMGREIAGKRLGLVGFGAIARETARRAAALDMTVSAHDPFVA
PDDPAWNPAYGPVALSSLDALIAESDVLSLHVPLTDGTRGLIGAEAIARMPKGAVLINAA
RGGVVDEAAVAAALRAGHLGGAALDVFEREPLDAGAGAVFADVPNLVLTPHIAGVTSESN
VRVSAVTARAVRRHLTER
NT seq 957 nt   +upstreamnt  +downstreamnt
atgcccgaaggatccacccccaaggtcgtcatcagcgagttcatggacgaggcggcgatc
gccgccgaactccagggcttcgacaccctctacgatcccggcctcgtcgaccgccccgac
gcgctggccgccgcgctgaaaggggccgacgcgctcatcgtgcgcaatcggacgcaggtg
cgcggcgctctgctggagggcgcccccgacctcaaggtggtgggccgcctcggggtcggc
ctcgacaacatcgacgtcgcggcctgccgcgcgcgcaacatcgcggtctaccctgcgacc
ggcgccaatgacgggtcggtggccgagtacgtgatcggcaccgcgatgctgctcctgcgc
ggcgcctacggggccaccgcggcggtcgcggccggtacgtggccgcgcaacgccctgatg
ggccgcgagatcgccggcaagcgcctcggcctcgtcggattcggcgccatcgcccgcgag
acggcccgccgcgccgcagccctcgacatgacggtctccgcgcacgaccccttcgtcgcc
cccgacgacccggcgtggaacccggcttacggcccggtcgcgctaagcagcctcgacgcg
ctgatcgccgagagcgacgtgctctcgctgcacgtgccgctcaccgacggcacccgcggc
ctgatcggcgcggaggcgatcgcccggatgccgaagggcgccgtgctgatcaacgcggcc
cgcggcggcgtggtggacgaggcggcggtcgccgccgcgctccgcgccggtcatctcggc
ggcgcggccctcgacgtgttcgagcgcgagccgctcgacgccggggccggcgcggtcttc
gccgacgtgccgaacctcgtcctcaccccgcacatcgcgggcgtgacaagcgaatcgaat
gtgcgcgtctcggccgtcaccgcgcgggccgtgcgccgccacctcacggagcgctag

DBGET integrated database retrieval system