KEGG   Methylobacterium sp. 17Sr1-43: DK427_02135
Entry
DK427_02135       CDS       T05919                                 

Definition
(GenBank) C4-dicarboxylate transporter DctA
  KO
K11103  aerobic C4-dicarboxylate transport protein
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_02135
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:meti02000]
    DK427_02135
Transporters [BR:meti02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   DK427_02135
SSDB
Motif
Pfam: SDF Sensor_TM1 DUF2686
Other DBs
NCBI-ProteinID: AWN34682
UniProt: A0A2U8VMS0
LinkDB
Position
complement(481711..483066)
AA seq 451 aa
MRLLRSIYGQVLLGIALGIAVGVVAPEFAVGCKILGDMFINLIKMIVAPVIFCTVVVGIA
HVGDMKAVGRMGLKTIVYFELATTVALAAGLIFVNVLRPGDGVNATVESLDAKLVAGIAG
KAHAQSPMEIVANIIPHSAVDAFAKGDLIQVMFFSVLVGMGLAMLGRKGEFPLRVVHAFG
DVLMKVVGIIMHFAPVGAFGAMAFTIGKFGLGILAQYGMLIVSLYLTFIVFIVFFLGGVM
RFYVGLSLWKLFRYSREEMFILLGTTSSESVLPRIMAKLNGLGVDKSVTGLVMPAGLSFN
MDGSCIYLTMAVGFIAQALNIPLTWEQELGILAIALVTSKGVAGVAGAILFVLAATLQAS
QLLPVAGIALIIGVDRILNELRCVTNAVGNMVATLVIARWEGKIDLAHARAVLDGRITPN
LDTLDDESDADLPAQEPATLRGPLPAAVPAT
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgcggttgttgcggtcgatctacggccaggtcctgcttggcatcgcgctcggcatcgcc
gtcggggtcgtcgcccccgaattcgcggtcggctgcaagatcctcggcgacatgttcatc
aacctgatcaagatgatcgtcgcccccgtcatcttctgcaccgtcgtggtcggcatcgcg
catgtcggcgacatgaaggccgttgggcggatgggcctgaagaccatcgtgtatttcgaa
ctcgccaccacggtggcgctcgcggcgggcctcatcttcgtcaacgtcctgcgtcccggt
gacggggtgaacgccacggtcgagagcctcgacgcgaagctcgtggcgggcattgccggc
aaggcgcacgcccagtcgccgatggagatcgtcgccaacatcatcccgcacagcgcggtc
gatgccttcgccaagggcgacctgatccaggtgatgttcttctccgtcctcgtcgggatg
ggactggccatgctcggccgcaagggcgagttcccgctgcgcgtggtccacgccttcggc
gacgtgctgatgaaggtggtgggcatcatcatgcacttcgcccccgtcggcgccttcggc
gcgatggccttcaccatcggcaagttcggcctcggcatcctggcccagtacgggatgctg
atcgtctcgctctacctgaccttcatcgtctttatcgtgttcttcctcggcggggtgatg
cgattctacgtgggcctcagtctgtggaagctgttccgctacagccgcgaagagatgttc
atcctgctcggcaccaccagttcggaatcggtgctgccgcggatcatggccaagctcaac
gggctcggcgtggacaagagcgtgacgggcctcgtgatgccggccggcctctccttcaac
atggacggctcgtgcatctacctgaccatggcggtcggcttcatcgcccaggcgctcaac
atcccgctgacctgggagcaggaactcggcatcctggcgatcgcgctcgtcacctcgaag
ggcgtggcgggggtcgcgggcgccatcctgttcgtgctggccgcgacccttcaggcctcg
cagctcctgccggtggccggcatcgcgctgatcatcggcgtggaccgcatcctgaacgag
ctgcgctgcgtgacgaacgcggtcggcaacatggtggcgaccctcgtgatcgcccgctgg
gagggcaagatcgacctcgcccacgcccgcgcggtgctcgacggccgcatcaccccgaac
ctcgacaccctggacgacgagagcgacgccgacctgcccgcgcaagagccggccacgctc
cggggtcccctgccggccgccgtgccggcgacctga

DBGET integrated database retrieval system