KEGG   Methylobacterium sp. 17Sr1-43: DK427_02925
Entry
DK427_02925       CDS       T05919                                 

Definition
(GenBank) [protein-PII] uridylyltransferase
  KO
K00990  [protein-PII] uridylyltransferase [EC:2.7.7.59]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_02925
Enzymes [BR:meti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.59  [protein-PII] uridylyltransferase
     DK427_02925
SSDB
Motif
Pfam: GlnD_UR_UTase ACT HD ACT_6 ACT_4 GlnE NTP_transf_2
Other DBs
NCBI-ProteinID: AWN34822
UniProt: A0A2U8VN49
LinkDB
Position
complement(666662..669457)
AA seq 931 aa
MFDAAAALDRILTDLDREAREPTKLRAALVPQLKAVIAEGHAAAEAQLLKDRDGMACAQA
LSRLTDAVVRAIYDAVCWRLYPNDNPTTGEQLAIVATGGYGRGTMAPGSDIDLLFLLPYK
QTAWSESVVEAMLYVLWDLKLKVGHATRSVEECLREARADFTIRTALLEARFLFGSRILF
EELITRFDSELVVGSAAEFVEAKLRERDGRVSKAGSSRYLVEPNVKDGKGGLRDLNTLFW
IAKYTYRVRDQAELVHAGLFTPDEYRLFERCEEFLWRVRCHMHFLTGRPEERLSFGLQPR
VAERLNYGPRGGLSGVERFMKAYFLIAKDVGDLTAIVCAELEARHAKRTPVLDRWIGRFR
DRFRATAMEAEDFWIDHGRVNLRAEDAFERDPVNLIRLFWLAERHNLPIHPDARRLATRS
LRLITPTLRADEEANRLFVEILTSKNAPESVLRQMNEAGVLGRFIPDFGRIVAMMQFNMY
HHFTVDEHLLRSVGVLAAIEAGRVQEAHPLVSRVIHTINNRTALYVAILLHDIAKGRPED
HSVAGAAIAQRLCPRLGLSQAETETVAWLVEHHLLMSMTAQSRDLSDPKTIERFAGVVQT
LERLKLLTILTVADIAAVGPGVWTAWKGTLLRTLYDETEVRLSGGHSEIARTDRVRMIQI
ALREKLPDWSAEEFDAYAARHNQAYWLKVEGVRQFKDANFIRGVVESGRTSATDVETDPV
RGVTEITVYSPDHPRLLAIITGACAAAGGNIVDAQIFTTSDGFALDSIYVSRAFERDEDE
LRRGQRITAAIERALKGEIRIADLVADKHPPVASARAKTFLVPPDMAIDNALSSRETVVE
VTGLDRPGLLYELTTAFSRLSLNITSAHIATFGERAVDVFYITDLIGTRVTQPDRLAAIR
AAVMEIFAGDVAALKAEGLEALVAAPPPREA
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgttcgacgccgccgccgccctcgacaggattctgaccgatctcgaccgcgaggcgcgg
gagccgacgaagctgcgggccgccctcgtgccgcagctcaaggcggtcatcgccgagggc
cacgcggcggccgaggcccagctcctcaaggatcgcgacgggatggcctgcgcgcaggcc
ctgtcgcggctcaccgacgcggtggtgcgggcgatctacgacgcggtctgctggcgcctc
tacccgaacgacaacccgacgacgggcgagcagctcgcgatcgtggcgaccggcggctac
ggccggggcacgatggcgccgggctccgacatcgatctgctgttcctgctgccctacaag
cagaccgcgtggtcggagagcgtcgtcgaggcgatgctctacgtgctctgggacctcaag
ctgaaggtcggccacgccacgcgctcggtcgaggaatgcctgcgcgaggcgcgcgcggac
ttcacgatccgcacggcgctcttggaggcccgcttcctgttcggctcgcgcatcctgttc
gaggagctgatcacccgcttcgattccgaactcgtcgtcggctcggccgccgagttcgtg
gaggcgaagctgcgcgagcgcgacgggcgggtctcgaaggccggctcctcccgctacctc
gtcgagccgaacgtcaaggacggcaaggggggcctgcgcgacctcaacaccctgttctgg
atcgccaagtacacttaccgggtgcgcgatcaggccgagctcgtccatgcgggcctgttc
acgcccgacgagtaccggctgttcgagcgctgcgaggagttcctgtggcgcgtgcgctgc
cacatgcacttcctcaccggccgccccgaggagcggctctccttcgggctccagccgcgc
gtggccgagcgcctcaactacgggccgcgcggcggcctgtcgggcgtcgagcgcttcatg
aaggcctatttcctgatcgccaaggacgtgggcgacctcaccgccatcgtctgcgcggag
ctggaggcgcgccacgccaagcgcacgccggtgctcgaccgctggatcggccgtttccgc
gaccgcttccgcgcgaccgccatggaggcggaggatttctggatcgaccacggccgggtg
aacctcagggccgaggacgccttcgagcgcgaccccgtcaacctgatccgcctgttctgg
ctggccgagcggcacaacctgccgatccacccggacgcgcggcgcctcgccacccgctcg
ctgcggctgatcacccccacgcttcgcgccgacgaggaggcgaaccggctcttcgtcgag
atcctgacctcgaagaacgcgccggaatccgtgctgcgccagatgaacgaggcgggcgtg
ctcggccgcttcatccccgatttcgggcgcatcgtggcgatgatgcagttcaacatgtac
caccacttcacggtggacgagcacctgctgcgctcggtcggcgtgctggcggcgatcgag
gcgggccgggtgcaggaggcgcacccgctggtctcgcgggtgatccacaccatcaacaac
cgcaccgcgctctacgtggcgatcctcctgcacgacatcgccaagggccggcccgaggac
cactcggtggcgggcgcggccatcgcccagcggctctgcccgcgcctcggcctctcccag
gccgagaccgagacggtggcctggctcgtcgagcaccacctcctgatgtcgatgacggcc
cagagccgcgacctctccgacccgaagacgatcgagcgcttcgcgggcgtggtgcagacg
ctggagcggctgaagctcctcaccatcctgacggtcgccgacatcgccgccgtcggcccc
ggcgtctggaccgcctggaagggcacgctgctgcgcaccctctacgacgagaccgaggtg
cggctctcgggcggccactccgagatcgcccgcaccgaccgggtgcggatgatccagatc
gcgcttcgcgagaagctgccggactggtcggccgaggagttcgacgcctacgcggcccgc
cacaaccaggcctactggctgaaggttgagggcgtgcgccagttcaaggacgcgaacttc
atccggggcgtggtcgagtcgggccgaaccagcgccaccgatgtcgagaccgacccggtg
cggggcgtgaccgagatcacggtctactcgcccgaccacccgcggcttctggccatcatc
accggcgcctgcgcggcggccggcggcaacatcgtggacgcgcagatctttaccacgagc
gacggcttcgctctcgactcgatctacgtctcccgcgccttcgagcgcgacgaggacgag
ctgcgccggggccagcgcatcaccgcggcgatcgagcgggcgctcaagggcgagatccgc
atcgccgatctcgtcgccgacaagcacccgccggtggcgagcgcgcgcgccaagaccttc
ctggtgccgcccgacatggcgatcgacaacgcgctgtcgagccgcgagaccgtggtcgag
gtcaccggcctcgaccggccgggcctcctctacgagctgaccaccgccttcagccggctc
tcgctcaacatcacctcggcgcatatcgcgaccttcggcgagcgcgcggtcgacgtgttc
tacatcaccgacctcatcggcacccgggtcacgcagcccgaccgcctcgccgcgatccgg
gccgccgtgatggagatcttcgcgggcgatgtcgcggcgctgaaggccgaggggctggaa
gcgctggtcgccgcgcccccgccgcgggaagcctga

DBGET integrated database retrieval system