KEGG   Methylobacterium sp. 17Sr1-43: DK427_03995Help
Entry
DK427_03995       CDS       T05919                                 

Definition
(GenBank) preprotein translocase subunit SecG
  KO
K03075  preprotein translocase subunit SecG
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02024  Quorum sensing
meti03060  Protein export
meti03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    DK427_03995
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    DK427_03995
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DK427_03995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:meti02044]
    DK427_03995
Secretion system [BR:meti02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   DK427_03995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecG
Motif
Other DBs
NCBI-ProteinID: AWN35007
UniProt: A0A2U8VN33
LinkDB All DBs
Position
complement(887381..887806)
Genome map
AA seq 141 aa AA seqDB search
MQTVLIVVHLLIVLALIGVVLLQRSEGGLGLGGGGSGGVSGFMTGRGQANALTRATAILA
ALFFVTSMTLAVMSHRAAGPRSILDGAGTNQPARQQPGGADNLLDTLRQQQNQGTTSAPG
AAPAAPAPSQPAGPPEAPQSR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgtcctgatcgtcgtccacctcctcatcgtgctcgcgctgatcggcgtcgtg
ctgctgcagcgctccgagggcggcctcgggctcggcggtggcggcagcggcggcgtctcc
ggcttcatgaccggccgcggccaggccaacgcgctcacccgcgccaccgcgatcctggcc
gccctgttcttcgtcaccagcatgacgctcgccgtgatgtcgcaccgcgccgccggcccg
cgctcgatcctcgacggcgccggcacgaatcagccggcgcgccagcagccgggcggcgcc
gacaacctgctcgacaccctgcgccagcagcagaaccagggcacgacgtccgcgccgggt
gctgctcccgccgcgcccgccccgagccagcccgccggcccgcccgaggcaccgcaatcc
cgctga

DBGET integrated database retrieval system