KEGG   Methylobacterium sp. 17Sr1-43: DK427_06830
Entry
DK427_06830       CDS       T05919                                 

Definition
(GenBank) methyl-accepting chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
meti02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_06830
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    DK427_06830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:meti02035]
    DK427_06830
Bacterial motility proteins [BR:meti02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    DK427_06830
SSDB
Motif
Pfam: MCPsignal 4HB_MCP_1 HAMP DUF948 DUF1664 AAA_13
Other DBs
NCBI-ProteinID: AWN38894
UniProt: A0A2U8VYN0
LinkDB
Position
complement(1522672..1524357)
AA seq 561 aa
MSGLRTIGAKVGLGLAIMFGLVAALGALSVRELRAVNGEAAELRDTHLPATQILGKIQVL
VLRQRVNGVRIISADTPELRADVQATVDKRDRELTDLRSAYRALPATAEAQALFAAYERE
WEAYQGLQARIAAIAASGDRDGAQKIYITTMSTGIGKVLGELQKLVELNDGYAGASGDRA
RAVYERGLTFTLLLVGLVVAVIAAAILGLVLHVGRPARRITDAMNRLAGGETGLAIPGAG
RRDEIGAMAAALQVFRDNLIRTRQLEEETALARAGAEAQRKAAMREMADGFERAVGGIIG
TVSSAASELQATAQSMASTARETAGQSVSVAAAAEQAAANVTTVAAAAEELGASVSEIGR
QVDGSAGLAEAAVGEAEQTSALVQELSSATARIGDVVALISQIAGQTNLLALNATIEAAR
AGEAGRGFAVVAAEVKELANQTAKATEEITQQIGRIQGSTGQAVSAIGGISARIRELSGA
VTSIAAAVEEQGAATQEIVRNVTQAAAGTDEVTTNIAGVATASEETGAAAAQVLGAADEL
SRQSEHLNAEVGRFLATVRAA
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgtcgggactgcgcaccatcggtgccaaggtcgggctcggcctcgcgatcatgttcggc
ctcgtcgcggcgctcggcgcgctgtcggtgcgcgagttgcgcgcggtcaacggcgaggca
gccgagctgcgcgacacccacctgccggccacccagatcctcggcaagatccaggttctg
gtgctccggcagcgcgtcaacggggtgcggatcatctcggcggacacgccggagctgcgc
gccgacgtccaggcgaccgtcgacaagcgcgaccgcgagctcaccgacctgcgttccgcc
tatcgcgcgctccccgcgaccgccgaggcgcaggccctcttcgcggcctacgagcgtgag
tgggaggcctaccagggcctccaggcgcggatcgccgccattgcggcttccggcgaccgg
gacggcgctcagaagatctacatcaccaccatgtcgaccgggatcggcaaggtactgggc
gagctgcagaagctcgtcgagctgaacgacggctacgcgggcgccagcggcgaccgggcc
cgggccgtctacgagcgcggcctcactttcaccctcctcctcgtcggcctcgtggtcgcg
gtgatcgcggcggccatcctcgggctcgtcctgcatgtggggcggccggcgcggcggatc
acggacgcgatgaaccgcctcgccggcggcgagacagggctcgccatcccgggggcgggc
cggcgcgacgagatcggcgcgatggccgcggccctgcaggtgttccgcgacaacctgatc
cgcacgcgccagttggaggaggagacggcgctcgcccgtgccggcgcggaagcacagcgc
aaggcggcgatgcgcgagatggccgacggcttcgagcgcgcggtcggcggcatcatcggc
acggtctcgtcggcggcgagcgagctgcaggccaccgcccagagcatggcgtccaccgcg
cgggagacggccggccagtccgtctcggtcgcggcggcggccgagcaggcggcggccaac
gtcacgacggtcgcggcggcggccgaggaactcggcgcctccgtctcggagatcggccgg
caggtcgacggctcggccgggctcgccgaggcggcggtcggcgaggcggagcagacctcc
gccctcgtgcaggagttgagcagcgcgaccgcccgcatcggcgacgtggtggcgctgatc
tcgcagatcgcgggccagacgaacctgctggccctgaacgcgacgatcgaggcggcgcgg
gccggcgaggcggggcgcggcttcgcggtggtggcggccgaggtcaaggaactcgccaac
cagaccgccaaggcgaccgaggagatcacccagcagatcggccggatccagggctcgacc
ggtcaggcggtgagcgccatcggcggcatatcggcgcgcatccgcgaactcagcggcgcc
gtgacatcgatcgcggcggcggtggaggagcagggcgcggcaacccaggagatcgtgcgc
aacgtgacccaggccgcggccggcacggacgaggtgaccacgaacatcgcgggcgtggcc
acggcctccgaggagaccggggccgccgccgcccaggtgctcggcgcggccgacgagctg
tcgcgccagtccgagcacctgaacgccgaggtcggccgcttcctcgcgaccgtgcgcgcc
gcctga

DBGET integrated database retrieval system