KEGG   Methylobacterium sp. 17Sr1-43: DK427_07790
Entry
DK427_07790       CDS       T05919                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K14981  two-component system, OmpR family, response regulator ChvI
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_07790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:meti02022]
    DK427_07790
Two-component system [BR:meti02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   DK427_07790
SSDB
Motif
Pfam: Response_reg Trans_reg_C GerE
Other DBs
NCBI-ProteinID: AWN35654
UniProt: A0A2U8VPT9
LinkDB
Position
1718317..1719027
AA seq 236 aa
MPTIALVDDDRNILTSVSIALETEGYRIQTYTDGASALDGLRHSPPDLAIFDIKMPRMDG
MELLRRLRQKSDLPVIFLTSKDEEIDELFGLKMGADDFIHKPFSQRLLVERVKAVLRRFA
PKDGPGAPPREADAAARSLERGALMMDPERHTCTWKGEPVTLTVTEFLILQALAHRPGVV
KSRNALMDAAYDDQVYVDDRTIDSHIKRLRKKFKVTDTNFDMIETLYGVGYRFKEG
NT seq 711 nt   +upstreamnt  +downstreamnt
atgccgaccatcgccctcgtcgacgacgaccgcaacatcctcacctccgtgtcgatcgcc
ctggagaccgaaggataccggatccagacctacacggacggcgcctcggcgctcgacggg
ctgcggcactcgccgccggatctggccatcttcgacatcaagatgccgcgcatggacggg
atggagcttctcaggcgcctgcggcagaaatcggaccttccggtgatctttctgacgtcc
aaggacgaggagatcgacgagctgttcggcctgaagatgggcgcggacgacttcatccat
aagccgttctcgcagcgcctgctggtcgagcgcgtgaaggccgtgctgcgccgcttcgcc
ccgaaggacggcccgggcgcgccgccccgcgaggcggatgccgccgcccgctccctggag
cgcggcgccctgatgatggacccggagcgccacacctgcacctggaagggcgagccggtg
acgctgaccgtgaccgagttcctgatcctgcaggccctggcccaccgccccggcgtcgtg
aagagccgcaacgccctgatggacgcggcctacgacgatcaggtctacgtggacgaccgc
accatcgacagccacatcaagcggctgcgcaagaagttcaaggtgacggacacgaacttc
gacatgatcgagactctgtacggggtcggctaccgcttcaaggaaggctga

DBGET integrated database retrieval system