KEGG   Methylobacterium sp. 17Sr1-43: DK427_09810
Entry
DK427_09810       CDS       T05919                                 

Definition
(GenBank) cytochrome ubiquinol oxidase subunit I
  KO
K00425  cytochrome bd ubiquinol oxidase subunit I [EC:7.1.1.7]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti00190  Oxidative phosphorylation
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DK427_09810
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_09810
Enzymes [BR:meti01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)
     DK427_09810
SSDB
Motif
Pfam: Cyt_bd_oxida_I
Other DBs
NCBI-ProteinID: AWN38933
UniProt: A0A2U8VYR2
LinkDB
Position
2145302..2146720
AA seq 472 aa
MLANVDALLLARWQFGFTVAFHIVFPAFSIGLASYLAVLEGLWLATDRQVFIDLFRYWIK
IFAIGFAMGVVSGLVMSYQFGTNWSVYADKTGPVLGPLMAYEVLTAFFLEAGFLGVMLFG
MRKVGPRLHFLATLMVAIGTFFSAFWILSVNSWMQTPQGHTVNAAGQFVPADWWAIIFNP
SFPFRLVHMVLAAYLTTALVVGAVGAWHLLRDRTNEGARTMFSMAMWMIAVVAPIQILAG
DAHGLNTLEHQPTKVMAMEGHFQSHPDGAPLILFGLPDQEAATVRYAIEVPKLSSLILKH
GLDEPLKGLDTVPRENWPPVPVVFWSFRVMVGLGLLMLLLGCLSLLARYRGGLYQWAGLH
RFALAMGPAGFVAVLAGWITTEVGRQPFTVYGILRTAESASPLHAPAVASSLIAFVLIYF
AVFGMGILYILHLMAKSPTRGEHGIEPGAPIRTAGITPAPSVDLGRSPQPAE
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgctcgcgaacgttgacgccctgctgctcgcgagatggcagttcgggttcacggtggcc
ttccacatcgtgttcccggccttctccatcggcctcgccagctacctggcggtgctggag
ggtctgtggctggcgaccgaccggcaggtgttcatcgacctgttccggtactggatcaag
atcttcgccatcggcttcgccatgggcgtcgtgtcgggcctcgtcatgtcctaccaattc
ggcacgaactggtcggtctacgccgacaagacgggtcccgtgctcggcccgttgatggcc
tacgaggtgctcacggccttcttcctggaggcgggcttcctgggggtgatgctgttcggc
atgcgaaaggtcgggccgcgcctgcacttcctcgccaccctgatggtggccatcggcacc
ttcttctcggcgttctggatcctgtccgtgaactcctggatgcagacgccgcaggggcac
acggtcaacgcggccggccaattcgtgccggccgactggtgggccatcatcttcaaccca
tccttccccttccgcctcgtccacatggtcctggccgcctacctgaccaccgcgctcgtt
gtgggcgcggtcggcgcctggcacctgctgcgcgaccgcaccaacgagggcgcgcggacg
atgttctcgatggcgatgtggatgatcgccgtcgtggcgccgattcagatcctggccggc
gacgcccacggcctgaacacgctggagcaccagccgaccaaggtcatggccatggagggc
cacttccagagccacccggacggcgcgccgctgatcctgttcggcctgcccgaccaggag
gccgccacggtccgctacgcgatcgaggtgccgaaactgtcctcgctgatcctgaagcac
ggcctcgacgagcccctgaagggactcgacaccgtgccgcgggagaactggccgccggtg
cccgtggtgttctggtccttccgggtgatggtagggctcggcctgctgatgctcttgctg
ggctgcctcagcctgctcgcccgctacaggggcgggctttaccagtgggcgggattgcac
cgcttcgccctcgccatggggcccgccggcttcgtcgccgtcctggccggctggatcacc
acggaggtcggacgccagcccttcaccgtctacgggatcctgcgcacggcggaatcggcc
tcgccgcttcacgcacccgccgtcgcctcgtcgctcatcgctttcgtgctgatctacttc
gctgtcttcgggatgggcatcctctacatcctgcacctgatggcgaagtccccgacgcgg
ggcgagcacgggatcgagcccggcgcgccgatccgcaccgctggcatcacgcccgcgccg
tcggtcgatctcggccgcagcccgcaaccggcagagtag

DBGET integrated database retrieval system