KEGG   Methylobacterium sp. 17Sr1-43: DK427_10135
Entry
DK427_10135       CDS       T05919                                 

Definition
(GenBank) glutamate ABC transporter permease
  KO
K10003  glutamate/aspartate transport system permease protein
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02010  ABC transporters
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DK427_10135
  09132 Signal transduction
   02020 Two-component system
    DK427_10135
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:meti02000]
    DK427_10135
Transporters [BR:meti02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter
    DK427_10135
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: AWN36040
UniProt: A0A2U8VRF3
LinkDB
Position
2202961..2203683
AA seq 240 aa
MNYNWNWGIFLEPSPEGAGTYADMLLSGLLWTIATALCSWVIAFCLGSIIGVLRTLPNKA
ANAVGTAYVELFRNIPLLVQMFLWYFVLPEVLPQSWGNWLKQLPNAPFYTGVVCLGFFTA
SRVAEQVRAGIQALPRGQRMAGTAMGFTVAQTYRYVLLPNAYRIILPPLTSEFLNNLKNT
SVALTIGLLELTARARSMQEFSFQVFEAFTAATLLYVLINIVVITAASFIERSVAVPGQR
NT seq 723 nt   +upstreamnt  +downstreamnt
atgaattacaactggaactggggcatcttccttgagccctcgcccgaaggcgccggcacc
tacgccgacatgctgctctcggggctcctctggacgatcgcaaccgcgctctgctcctgg
gtgatcgcgttctgcctgggctccatcatcggcgtcctgcgcaccctgccgaacaaggcg
gccaacgcggtcggcacggcctatgtcgagctcttccggaatatcccgctgctcgtgcag
atgttcctctggtacttcgtgctgccggaggtgctgccgcaatcctggggcaattggctg
aagcagctaccgaacgcgcccttctacaccggcgtggtctgcctcggcttcttcaccgcc
tcgcgcgtggccgagcaggtgcgggccggcatccaggcgcttccgcggggccagcgcatg
gctggcaccgcgatgggcttcaccgtggcgcagacctaccgctacgtactcctgccgaac
gcctaccgcatcatcctgccgccgctgacctccgagttcctgaacaacctcaagaacacc
tcggtcgcgctcaccatcggtctcctggaactcaccgcccgggcacgctcgatgcaggaa
ttctccttccaggtgttcgaggccttcacggccgccaccctcctctacgtcctcatcaac
atcgtggtgatcacggcggcctcgttcatcgagcgctccgtggccgtgccgggacagcgc
tga

DBGET integrated database retrieval system