KEGG   Methylobacterium sp. 17Sr1-43: DK427_11320Help
Entry
DK427_11320       CDS       T05919                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti00061  Fatty acid biosynthesis
meti00780  Biotin metabolism
meti01100  Metabolic pathways
meti01212  Fatty acid metabolism
Module
meti_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:meti00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DK427_11320 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DK427_11320 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:meti01004]
    DK427_11320 (fabZ)
Enzymes [BR:meti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     DK427_11320 (fabZ)
Lipid biosynthesis proteins [BR:meti01004]
 Fatty acid synthase
  Component type
   DK427_11320 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AWN36235
UniProt: A0A2U8VRG8
LinkDB All DBs
Position
2457198..2457662
Genome map
AA seq 154 aa AA seqDB search
MTETVQELGAADIQKVLELLPHRYPFLMIDRIIEIDRDESCIGIKNVTVNEPQFTGHFPN
MPVFPGVLLIEGMAQTAGAICCRHIMSETVQTKQVFFMTIDKCKFRKPVVPGDQVRFHMK
KLNQRKTMWWFRGEARVDGALVAEAEIGAMLVTA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgacggagacggtgcaggaactcggagcggcggacatccagaaggtgctggagctcttg
ccccaccgctacccgttcctgatgatcgaccggatcatcgagatcgatcgcgacgagagc
tgcatcggcatcaagaacgtcacggtgaacgagccccagttcaccggccacttccccaac
atgcctgtcttccccggcgtgctgctgatcgagggcatggcccagacggcgggcgcgatc
tgctgccggcacatcatgtcggagacggtccagaccaagcaggtcttcttcatgaccatc
gacaagtgcaagttccgcaagcccgtggtgccgggcgaccaggtgcggttccacatgaag
aagctcaaccagcgcaagaccatgtggtggttccgcggcgaggcccgggtcgacggcgcg
ctggtggccgaggccgagatcggcgccatgctggtgaccgcgtga

DBGET integrated database retrieval system