KEGG   Methylobacterium sp. 17Sr1-43: DK427_13465
Entry
DK427_13465       CDS       T05919                                 

Definition
(GenBank) efflux transporter periplasmic adaptor subunit
  KO
K07798  membrane fusion protein, copper/silver efflux system
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_13465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:meti02000]
    DK427_13465
Transporters [BR:meti02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   DK427_13465
SSDB
Motif
Pfam: HlyD_D23 HlyD_3 HlyD Biotin_lipoyl_2 Biotin_lipoyl HlyD_2
Other DBs
NCBI-ProteinID: AWN36617
UniProt: A0A2U8VSF0
LinkDB
Position
2894407..2895888
AA seq 493 aa
MTRSAWFAGTLAALAAGGLGYWAGQQDGPVPAFVERVRHGVARLLPAAQAPARSKPASGP
VVYYWDPDGKPVYSASPMVTADGREFRAVRASEDVRFDDGDGETMPADMAGHHAEPGEAA
KPGGDARRVLYYRNPMGLADTSSVPKKDSMGMDYIPVYAGEDEAGVVKVSPGKVQRTGVR
TELAERRVLSVPVRAPGSVGEDERRVSVIAMRTDAFIEKVEPVTTGDHVRKGQPLLRLFA
PEINAVAAQYLTSIGYEGGRRRLENLAIPPEVIDEIERTHKVPPSITWSAPRDGVVVERN
VSDGMKAKSGDVLFRIVDHTRVWVLADVTERDLAGVAEGQKATVRARAFPDRTFSGTVTR
IYPHLNMETRTARLRIELPNPDGVLRPSMYADVEIATGDAKPVVAVPDDAVIDTGERQVV
LLDHGEGRFEPKAVKVGLRGRGYVEIREGVTAGDRVVTAANFLIDAESNLKAALQSIAAP
KDDRQAAGTGATP
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgacccgctcggcatggttcgccggcaccctcgctgcgctcgcggcggggggcctcggc
tactgggccggacagcaggacggtcccgttccggcgttcgtcgagcgggtccggcacggc
gtcgcccgcttgctgcccgccgcgcaggcgccggcccggtccaagcccgcgtccggaccg
gtggtctactactgggacccggacgggaagcccgtctactcggcgtcgccgatggtgacg
gcggacggccgggagttccgggccgtccgcgccagcgaggacgtgcgcttcgacgacggg
gacggcgagaccatgcccgcagacatggccgggcaccacgcggagccgggcgaggcggcc
aagcccggcggtgacgcccggcgcgtcctctactaccggaacccgatgggcttggccgac
acctcgtcggtgccgaagaaggactcgatggggatggactacattcccgtctacgcgggc
gaggacgaggccggcgtcgtgaaggtctcgccgggcaaggtccagcgcaccggcgtgcgg
accgagctcgcggagcgccgggtcctgtcggtgccggtgcgggcgccgggcagcgtcggg
gaggacgagcgccgcgtctccgtcatcgccatgcgcacggacgccttcatcgagaaggtc
gagccggtcacaacgggcgaccacgtccgcaagggccagccgttgctgcgcctgttcgcg
cccgagatcaacgcggtcgcggcccagtacctgacctccatcggctacgagggcggccgt
cggcgtctagagaacctcgccatcccgccggaggtcatcgacgagatcgagcggacccat
aaggtgccaccctccatcacatggtccgcgccccgggacggcgtcgtggtcgagcgcaac
gtctcggacgggatgaaggccaagtccggcgacgtcctgttccgcatcgtcgaccacacg
cgtgtctgggtgctggccgacgtgaccgagcgcgacctcgccggggtggcggaggggcag
aaggcgacggtccgggcgcgggccttccccgaccggaccttcagcgggacggtgacccgg
atctacccgcacctcaacatggagacccggaccgcccggctgcgcatcgagctgccgaac
cccgacggcgtcctgcgcccgtcgatgtacgcggacgtcgagatcgcgacgggcgacgcc
aagccggtggtggcggtgcccgacgacgcggtcatcgacaccggcgagcgtcaggtcgtg
ctgctcgaccacggcgaggggcgcttcgagccgaaggcggtgaaggtcggcctgcgcggc
cggggctacgtcgagatccgcgagggggtcacggccggtgaccgggtggtcacggcggcg
aacttcctgatcgacgccgagagcaacctgaaggcggcgctccagtccatcgccgcaccg
aaggacgaccggcaggcggcgggcacgggggcgacgccatga

DBGET integrated database retrieval system