KEGG   Methylobacterium sp. 17Sr1-43: DK427_13470
Entry
DK427_13470       CDS       T05919                                 

Definition
(GenBank) CusA/CzcA family heavy metal efflux RND transporter
  KO
K07787  copper/silver efflux system protein
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_13470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:meti02000]
    DK427_13470
Transporters [BR:meti02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   DK427_13470
SSDB
Motif
Pfam: ACR_tran
Other DBs
NCBI-ProteinID: AWN36618
UniProt: A0A2U8VT79
LinkDB
Position
2895885..2899058
AA seq 1057 aa
MIARLIGWSARNLVLVLLGTVFAVAAGILALRSLPLDAIPDLSDVQAIVYTEYPGQAPQV
VEDQVTYPLTTAMLTVPKAKVVRGFSFFGVSFVYVIFEDGTDPYWGRSRVLEYLNGAASR
LPAGVTPMLGPDATGVGWVYQYVVVAKERTLAELRSMQDWVIRFGASRAEGVAEVAGVGG
FVKQYNVVVDPNRLRAQGISLNKLRDAIRSSNADVGGRTVELSEFEFMVRGRGYIRSLAD
IENVVLKTSGGTPLRVRDVARVELGPDERRGLTEMNGEGEVAGGIVLQRFGANALNVIEG
VKAKLAEVAKSLPAGTEILPVYDRSQLIDAAIDTLRHTLVEESVVVSLVCIVFLLHVRSA
LVAILMLPVGILMAFAGMKALGIGANIMSLGGIAIAVGAMVDAAIVMIENAHKHLERAPP
DKPRVEVLVEAASEVGPSLFFSLLVITVSFLPIFTLESQEGRLFGPLAYTKTFAMAAAAL
LSVTLVPALMVLFVRGRIVPEHRNPLNRLLIWLYRPLIAGVLRARVLTILLAVGVLAATA
WPARQLGSEFMPELDEGTLLYMPTTLPGISVTKAGELLATQDRIIKSFPEVASVYGKAGR
ANTATDPAPMEMFETVIALKPKAAWRPGVTLASLKAEMDAALQFPGVSNAWTQPIRARID
MLSTGIRTPVGVKVLGTDLTAMEGVARQVETVVRTVPGTSSVYAERVIGGYFLDVTPERE
ALGRYGLMVGDVQDVVATALGGQTVTNTVEGRERYTVNVRYPRAFRSDPRAIANEVQVPL
PGGGTVPLGEVAKVELTRGPTSIRTENGQLAVYLFVDIAGRDLGGYVAEARKAVADTVKL
PQGTSLQWSGQYEYLERAEARLSFVVPLTLLIVFLLLYLNFRRLTETLIVMLSLPFALVG
GVWLLWWMSFNMSVAVAVGFIALAGVAAETGVIMLVYLDHALDEVRAGCAREGRPLARAD
LQRAIMVGAVERVRPKMMTVVAIMAGLLPILWSTGSGSEVMQRIAVPMIGGMVSSTVLTL
VVIPAVYALVKGRGLPPADLVARKAADGNVRLPQAAE
NT seq 3174 nt   +upstreamnt  +downstreamnt
atgatcgcccgcctgatcggctggtcggcccgcaacctcgtgctggtgctgctcgggacc
gtgttcgctgtggcggccggcatcctggcgctcaggtctctgccgctcgacgccatcccc
gacctctcggacgtacaggccatcgtctacaccgagtacccgggacaggcgccgcaggtg
gtggaggaccaagtcacctatccgctgaccaccgcgatgctgacggtgccgaaggccaag
gtggtgcgcggcttctctttcttcggcgtgtccttcgtctacgtcatcttcgaggacggc
accgacccctactggggtcgctcccgcgtgctcgaatacctcaacggcgcggcgagccgc
ctgccggccggggtgacgccaatgctggggcccgacgcgaccggcgtcggctgggtctac
cagtacgtggtggtcgcgaaggagcggacgcttgcggagctccggtcgatgcaggactgg
gtcatccggttcggggcctcgcgcgccgagggtgtggccgaggtcgccggcgtcggcggc
ttcgtcaagcagtacaacgtcgtcgtcgacccgaaccgcctgcgggcccagggcatctcg
ctcaacaagctccgggacgccatccggtcaagtaacgccgacgtcgggggccgcacggtc
gagctctccgaattcgagttcatggtgcgcgggcgcggctacatccggagcctcgccgac
atcgagaacgtcgtgctgaagacctccggcggcacgccgctgcgggtcagggacgtcgcc
cgggtcgagctcgggccggacgagcggcgcggcctaaccgagatgaacggcgagggcgag
gttgccggtggcatcgtcctgcagcgcttcggggccaacgccctcaacgtcatcgagggc
gtgaaggcgaagctcgccgaggtcgccaagagcctgccggcgggcaccgagatcctgccg
gtctacgaccgctcgcagctcatcgacgcggccatcgacacactgcggcacacgctggtc
gaggagagcgtcgtcgtctccctcgtctgcatcgtcttcctgctgcacgtacgcagcgcg
ctcgtcgccatcctgatgctgccggtcggcatcctgatggccttcgccggtatgaaagcg
ctcggcatcggcgccaacatcatgagcctgggcggcatcgccatcgccgtaggtgccatg
gtcgacgccgccatcgtcatgatcgagaacgcccacaagcacctggagcgggcgccaccg
gacaaacctcgggtcgaggtcctggtcgaggcggcaagcgaggtcgggccgtccctgttc
ttctcgctcctcgtgatcacggtgagcttcctgccgatcttcaccctggagagccaggag
ggacggctgttcggaccgctcgcctacaccaagaccttcgccatggcggcggcggcgctc
ctctcggtcacgctggtgccggcgctgatggtgctgttcgtgcgcgggcgcatcgtcccc
gagcaccgcaacccgctgaaccgcctcctcatctggctgtaccggccgctcatcgccggt
gtgctgcgggcccgagtgctcaccatactgctcgccgtgggcgtgctggcggcgaccgca
tggccggcccggcaactcggctcggagttcatgccggagctcgacgagggtacgctgctc
tacatgccgacgacgctgccgggcatctcggtgaccaaggccggcgagctcctcgccacc
caggaccgcatcatcaagtcgttccccgaggtggcctcggtctacggcaaggccgggcgc
gccaacaccgcgaccgaccctgcgccgatggagatgttcgagacggtcatcgccctgaag
ccgaaggcggcgtggcggccgggcgtgacgctcgcgagcctcaaggccgagatggacgcg
gccctgcagttcccgggcgtgtcgaatgcctggacgcagccgatccgcgcccgcatcgac
atgctctcgaccggcatccgcaccccagtgggcgtgaaggtgctgggcaccgacctcacg
gcgatggagggggtggcccgccaggtggagacggtggtgcggaccgtgcctggcacgtcg
agcgtctatgccgagcgggtcatcgggggctacttcctcgacgtcacgccggagcgcgag
gcgctcgggcgctatggtctgatggtcggggacgtgcaggacgttgtcgcgacggccctc
ggtgggcagaccgtgacgaacaccgtcgagggccgcgagcgatacaccgtcaacgtgcgc
tacccgcgggccttccgctcggaccccagggccatcgcgaacgaggtgcaagtgccgctg
ccggggggcggcacggtgccgcttggcgaggtggccaaggtcgaactgacacgcgggccg
acctcgatccgcaccgagaacgggcaactcgcggtctacctgtttgtcgacatcgcgggg
cgagacctcggcggctacgtggccgaggcgcgcaaggccgtggcggacacggtcaagctg
ccgcagggcacgagcctgcagtggagcgggcagtacgagtacctggagcgggccgaggcg
cgcctctccttcgtggtgccgctgacgctgctgatcgtgttcctactcctctacctcaac
ttccggcggctgaccgagacgctcatcgtgatgctgtcgctgcccttcgccctggtcggc
ggggtgtggctgctctggtggatgagcttcaacatgtcggtcgcggtggcggtcggcttc
atcgccctggccggcgtcgccgccgagaccggcgtgatcatgctggtctatctcgaccat
gccctcgacgaggtccgcgccggctgcgcgcgcgagggccgcccacttgcgcgggcggac
ctgcagcgggccatcatggtcggtgccgtcgagcgggtacgcccgaagatgatgacggtg
gtcgccatcatggctggcctcttgcccatcctctggagcaccggctcgggctccgaggtc
atgcagcggatcgcggttcccatgatcggcgggatggtctcctcgacggtgttgacgctg
gtggtgatcccggcggtctacgccttggtgaaagggcgcgggttgccgccggcggatctg
gtcgctcgcaaggccgcggacgggaacgtgaggctgccgcaggcggccgagtga

DBGET integrated database retrieval system