KEGG   Methylobacterium sp. 17Sr1-43: DK427_14050
Entry
DK427_14050       CDS       T05919                                 

Gene name
petA
Definition
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti00190  Oxidative phosphorylation
meti01100  Metabolic pathways
meti02020  Two-component system
Module
meti_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:meti00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DK427_14050 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_14050 (petA)
Enzymes [BR:meti01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     DK427_14050 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske TAT_signal
Other DBs
NCBI-ProteinID: AWN36715
UniProt: A0A2U8VSP9
LinkDB
Position
3004641..3005216
AA seq 191 aa
MANTTAAAPAGAAPQEGTRRDFLFLATGAGLAVGTVAVAWPFVASMAPDAATIAAGAPLE
VDLSPISDGQIINVFWRGKLIFVRKLTEKEITDMKAVPVSQLIDPAAADTRVKKGHDQWL
VVYGNCTHLGCVPIGHSGNFEGWSCPCHGSQFDALGRVRRGPAPTNLPIPPYAFQSDTKI
RIGEEGGKAAA
NT seq 576 nt   +upstreamnt  +downstreamnt
ttggcgaacacgactgccgccgcgcccgccggcgccgccccgcaggagggcacccgccgg
gacttcctcttcctcgccactggtgccggtctcgcggtcggcaccgtcgcggtggcctgg
cccttcgtcgcctcgatggcgccggacgccgccaccatcgcggccggtgcgccgctggag
gtcgatctctcgccgatcagcgacggccagatcatcaacgtgttctggcgcggcaagctg
atcttcgtgcgcaagctcacggagaaggagatcacggacatgaaggccgtgccggtctcc
cagctgatcgacccggccgccgccgacacccgcgtcaagaagggccacgaccagtggctc
gtcgtctacggcaactgcacgcatctgggctgcgtgccgatcggccattccggcaatttc
gagggctggtcctgcccctgccacggctcgcagttcgacgccctcgggcgcgtgcgccgc
ggtcccgcccccaccaacctgccgattccgccctacgccttccagtcggacaccaagatc
cgcatcggcgaggagggcggcaaggccgccgcgtga

DBGET integrated database retrieval system