KEGG   Methylobacterium sp. 17Sr1-43: DK427_14060
Entry
DK427_14060       CDS       T05919                                 

Definition
(GenBank) cytochrome c1
  KO
K00413  ubiquinol-cytochrome c reductase cytochrome c1 subunit
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti00190  Oxidative phosphorylation
meti01100  Metabolic pathways
meti02020  Two-component system
Module
meti_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:meti00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DK427_14060
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_14060
SSDB
Motif
Pfam: Cytochrom_C1 Cytochrome_CBB3 Cytochrom_C
Other DBs
NCBI-ProteinID: AWN36717
UniProt: A0A2U8VSQ4
LinkDB
Position
3006560..3007468
AA seq 302 aa
MTIRTLLAATLVAASLGGALMGAPARADDGHTPQPPRQKWSYAGVFGSFDQGQLQRGFQV
YKEVCSACHSMKLVAFRNLAEPGGPGYSAAQVKALAATYQVKDGPNDSGEMFERPGRPAD
RFPPPFPNDQAAAAANGGKAPPDFSVLAKARTYERGFPWFVLDALPFTGYSEQGVDYIHA
LLVGYEDPPKGTEVPDGGHYNKYYPGHIIAMPNPISEGQVSYPKGDDGRPVVPETVDQYA
KDVSAFMAWAAEPHMMARKALGLRVILFLIVLAGLLYYVKKRVWADVGGETHGLQPELHK
TY
NT seq 909 nt   +upstreamnt  +downstreamnt
atgacgatccgcacgctcctcgccgcgaccctggtcgcggcctccctcggcggcgccctg
atgggcgccccggcccgggccgacgacggccacacgccccagccgccccgccagaagtgg
agctatgccggcgtgttcggcagcttcgaccagggccagctccagcgcggcttccaggtc
tacaaggaggtctgctcggcctgccacagcatgaagctcgtggccttccgcaacctcgcg
gagccgggcgggcccggctactcggccgcccaggtcaaggcgctcgccgcgacctaccag
gtcaaggacgggccgaacgattccggcgagatgttcgagcggcccggccgcccggccgac
cgcttcccgccgcccttcccgaacgaccaggcggcggccgccgccaacggcggcaaggcg
ccgccggacttctcggtgctggccaaggcccgcacctacgagcgcggcttcccgtggttc
gtgctcgatgcgctgcccttcaccggctactcggagcagggcgtcgactacatccacgcg
ctgctggtcggctacgaggacccgccgaagggtaccgaggtgccggacggcggccactac
aacaagtactatcccggccacatcatcgcgatgcccaaccccatcagcgagggtcaggtc
agctacccgaagggcgacgacggcaggcccgtggtacccgagacggtggaccagtacgcc
aaggacgtctcggccttcatggcttgggcggccgagccccacatgatggcccgcaaggcg
ctgggtctgcgggtgatcctgttcctgatcgtgctggccggcctgctctactacgtgaag
aagcgggtctgggcggatgtcggcggcgagacccacggtctccagccggagctgcacaag
acgtactga

DBGET integrated database retrieval system