KEGG   Methylobacterium sp. 17Sr1-43: DK427_16135
Entry
DK427_16135       CDS       T05919                                 

Definition
(GenBank) hybrid sensor histidine kinase/response regulator
  KO
K13490  two-component system, chemotaxis family, sensor histidine kinase and response regulator WspE
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_16135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:meti01001]
    DK427_16135
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:meti02022]
    DK427_16135
Protein kinases [BR:meti01001]
 Histidine kinases
  CheA family [OT]
   DK427_16135
Two-component system [BR:meti02022]
 CheA family
  WspE-WspRF (chemosensory)
   DK427_16135
SSDB
Motif
Pfam: Response_reg Hpt CheW HATPase_c
Other DBs
NCBI-ProteinID: AWN37070
UniProt: A0A2U8VUN1
LinkDB
Position
complement(3444614..3446920)
AA seq 768 aa
MADIRQLLLAAFEVEHREHIEAIRAALGTAGAGAAPDWNDIFRRAHSLKGAARAVDLPPV
EALAHRLETLFERVSTGAALDRAAESATQLALDRIEAYVAAIKEAPDAAMPGDALAALDG
CLGPDRSEDPASAPPAEAPAAPAFSASLSQLSAEPSTPPLPRPAAPAEPAPEPAQAILRV
PAETVEALSRASHDLTSALGGAPVAEGLARIARACTDLRRRVGGLAGAGQAADDTAGEAA
RAELRGLDGALAALAREAGDLARRHAAAAAVLDGAAARVRAEAERLALVPAETVLGLLAR
TLRETAREQGRDVAVATRGLDVPVDRAILQSLKDPVLHALRNALSHGWEPPEVRAAAGKP
EALQIGLEVALRGGRLVLTVWDDGRGPDLAAIAAQGRRRGLLVEGETPDPDALLALVFEP
GFSTASSIDTLAGRGFGLSVVADAARALQGSVRLGPRAPAGSQLVLSLPLAASRRSLLLV
EAGGATYALPGAGVARLLRVERAGLPQAMGRTLLRVAEAEGQGGGEAEASLPVAALSDLL
NLPAAAPGRNLTAVLLRAGGRRLALAVERLHDVRTLLVLPVPPVGADPDLVAGTAILAGD
VPVLVLDPEGLAARADGALPAASTAAPPDIDGEAAGTAPRARRSMVRATILVVDDSITTR
TLEKGILEAAGYRVVVCVDGQDALDRLRAEIEPVDLVLADVEMPRLDGFGLLRALRADER
FRRLPTVLMTSRGDPEDVARGLELGADAYLTKQKFDQSGLLETIGRLL
NT seq 2307 nt   +upstreamnt  +downstreamnt
ttggccgacatccgccagctcctgctcgccgccttcgaggtcgagcaccgcgagcatatc
gaggcgatccgcgccgcgctcggcaccgcgggggcgggcgccgcgcccgattggaacgac
atcttccgccgggcccacagcctgaagggcgccgcccgcgcggtcgatctgccgcccgtc
gaggcgctggcccaccggctggagaccctgttcgagcgggtcagcacgggcgccgccctc
gaccgcgcggccgagagcgccacgcagctcgccctcgaccggatcgaggcctacgtcgcc
gccatcaaggaggcgccggacgccgccatgccgggcgacgcgctggccgcgctggacggc
tgcctcggtccggaccggtcggaggatccggcttccgcgccgcccgccgaagcgccggcc
gcgcccgccttctccgcctcgctgtcccagctctctgccgaaccctccacaccgcccctg
ccgaggcccgccgccccggccgagccggcaccggagcccgcccaggcgatcctgcgcgtg
ccggccgagaccgtcgaggccctgtcccgggcgagccacgacctcaccagcgccctcggc
ggcgccccggtagcggagggcctcgcccgcatcgcccgcgcctgcaccgacctgcgccgc
cgggtcggggggctggcaggcgctggccaggctgccgacgacaccgccggcgaggcggcc
cgggcggagctgcgcggcctcgacggggcgctcgcggcgctcgcgcgcgaggccggcgac
ctcgcccgacgccacgccgccgccgccgcggtgctcgacggggccgccgcccgggtgcgc
gccgaggccgagcgcctcgccctcgtcccggccgagaccgtgctgggccttctcgcccgc
accctgcgcgagaccgcgcgcgagcagggccgcgacgtcgcggtcgccacccgcggcctc
gacgtcccggtggaccgggccatcctgcagagcctgaaggaccctgtcctgcacgccctg
cgcaacgcgctcagccacggctgggagccgccggaggtccgcgccgccgcgggcaagccc
gaggcgctgcagatcggcttggaggtcgcgctgcggggcgggcggctcgttctcaccgtc
tgggacgacggcaggggccccgacctcgcggcgatcgccgcgcagggccgccgccgcggc
ctcctcgtcgagggcgagacgccggatcccgacgcgctcctcgccctggtcttcgaaccg
ggcttctcgacggcttccagcatcgacaccctggcgggacgcggcttcggcctgtcggtg
gtggcggatgccgcccgcgccctccagggcagcgtgcgcctcggcccccgcgcgcccgcc
ggcagccagctcgtcctcagcctgccgctcgccgcctcccggcgcagcctgctcctggtc
gaggcgggtggggccacctacgccctgccgggcgcgggcgtggcgcgcctgctgcgggtc
gagcgcgccggtctgccgcaggccatgggccggaccctgctgcgcgtggcggaagccgag
ggccaaggggggggtgaggccgaggcgagtctcccggtcgcggcgctctccgacctcctg
aacctgccggcggcggcgcccggccggaacctcaccgccgtgctgctgcgggcgggcggg
cgccgcctcgccctcgcggtcgagcgtctgcacgacgtgcgcacgctcctcgtcctgccg
gtgccccccgtgggcgccgacccagacctcgtcgccggcaccgcgatcctggccggcgac
gtgccggtcctggtgctcgatcccgaggggctggccgcccgcgccgacggggccctgccc
gccgcctcgaccgcggctccgcccgacatcgacggcgaggccgccggaaccgcgccgcgg
gcgcgacgttcgatggtgcgcgcgacgattctggtcgtcgacgattccatcaccacccgc
accctggagaaaggcatcttggaagcggccggctaccgcgtggtcgtctgcgtggacgga
caggacgccctcgaccggctgcgcgccgagatcgagccggtggacctcgtcctcgccgat
gtcgagatgccgcgcctggacggcttcggcctgctgcgcgcgctccgggccgacgagcgc
ttccgccgcctgccgaccgtgctgatgacctcccggggcgaccccgaggacgtcgctcgc
ggcctcgaactcggcgccgacgcctacctgaccaagcagaagttcgaccagagcgggctt
ctcgagacgatcgggcgcctgctgtga

DBGET integrated database retrieval system