KEGG   Methylobacterium sp. 17Sr1-43: DK427_16505
Entry
DK427_16505       CDS       T05919                                 

Definition
(GenBank) two-component sensor histidine kinase
  KO
K14986  two-component system, LuxR family, sensor kinase FixL [EC:2.7.13.3]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_16505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:meti01001]
    DK427_16505
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:meti02022]
    DK427_16505
Enzymes [BR:meti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     DK427_16505
Protein kinases [BR:meti01001]
 Histidine kinases
  LuxR family [OT]
   DK427_16505
Two-component system [BR:meti02022]
 LuxR family
  FixL-FixJ (nitrogen fixation)
   DK427_16505
SSDB
Motif
Pfam: HATPase_c PAS_9 HisKA HATPase_c_2 PAS_8 HATPase_c_5 PAS
Other DBs
NCBI-ProteinID: AWN37134
UniProt: A0A2U8VTQ8
LinkDB
Position
complement(3532376..3533626)
AA seq 416 aa
MSSGPAAADSGIVVSYDADWNDAWYLVCMKVSTIGFVVVDARERVAALDALRARGVTDLS
GYLDANPGAANRLRRGMIILDVNEAAVRMFGAAGRADMIGQRTQRFFDPSCTAQVNSARA
FAEGAAAFQQQARSVRMDGSRFDTLFCVVPRADGVASGLWLASFVDITEHVQRQTALDAL
RDELAHVSRISTLGELSASIAHELGQPLSSIGMTAGAMLRRLDGPEIDRDTLRHQCRRIV
DQVARAGDIIDRTRRMAGKRGGLRSPVAIADVLAESIQFVQHELSRHAIDIQVGVSGPDL
VVQADRIQLQQVFVNLLMNAIQVHHGAGTPRPEIRIDAIRKDGTVRVDVADNGPGIEPSH
VDQLFDGFFTTRADGLGLGLSICRTIIAAHDGAIAVTSPSGSRGATFSVCLPIHLI
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgagcagcggtcccgcagcggcggacagcggcatcgtcgtctcctacgacgccgactgg
aacgacgcctggtacctcgtgtgcatgaaggtctcgaccatcggcttcgtcgtggtcgac
gcccgcgagcgggtcgccgcgctcgacgcgctccgggccaggggcgtgacggacctgtcg
ggctatctcgatgccaatcccggcgcggcgaaccggctgcgccgcggcatgatcatcctc
gacgtgaacgaggcggccgtgcggatgttcggcgccgccggccgcgccgacatgatcggg
cagcggacccagcgcttcttcgatccgagctgcaccgcgcaggtgaactccgcccgcgcc
ttcgcggagggggcggccgcgttccagcagcaggcccgcagcgtccggatggacggctcc
cgcttcgacacgctgttctgcgtcgtgccgcgggcggacggcgtcgcctcaggcctctgg
ctcgcctccttcgtggacatcacagagcacgtgcagcgccagaccgcgctcgacgcgctg
cgcgacgagctggcccacgtctcccggatctcgacgctcggcgagctctcggcctcgatc
gcccacgagctcgggcagcccctgtcctcgattgggatgaccgccggcgccatgctgcgc
cgcctcgacgggccggagatcgaccgcgacacgctccggcaccagtgccgccgcatcgtc
gatcaggtcgcgcgggccggtgacatcatcgatcgcacgcggcgcatggcgggcaagcgc
ggcggcctgcgcagccccgtggcgatcgccgacgtgctggctgaatccatccagttcgtg
cagcacgagctgagccggcacgcgattgacatccaggtcggcgtctccggcccggatctc
gtcgtccaggccgaccggatccagcttcaacaggtcttcgtgaacctcctgatgaacgcg
atccaggttcatcacggggccggcacgccccggcctgagatccggatcgacgcgatacgc
aaggacggcaccgtccgggtcgacgtggcggataacgggcctgggatcgagccgagtcat
gtagaccagctcttcgacgggttcttcaccacccgggcggacgggctcggcctcggcctc
agcatctgccgcaccatcatcgccgcgcatgacggcgcgatcgcggtgacgagccccagc
ggttcgcgcggtgcaacgttctccgtctgccttccaattcatctgatctga

KEGG   Methylobacterium sp. 17Sr1-43: DK427_20270
Entry
DK427_20270       CDS       T05919                                 

Definition
(GenBank) PAS domain-containing sensor histidine kinase
  KO
K14986  two-component system, LuxR family, sensor kinase FixL [EC:2.7.13.3]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_20270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:meti01001]
    DK427_20270
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:meti02022]
    DK427_20270
Enzymes [BR:meti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     DK427_20270
Protein kinases [BR:meti01001]
 Histidine kinases
  LuxR family [OT]
   DK427_20270
Two-component system [BR:meti02022]
 LuxR family
  FixL-FixJ (nitrogen fixation)
   DK427_20270
SSDB
Motif
Pfam: PAS HATPase_c PAS_3 PAS_9 PAS_4 HisKA PAS_8 HATPase_c_5 HATPase_c_2 PAS_10
Other DBs
NCBI-ProteinID: AWN37776
UniProt: A0A2U8VXB0
LinkDB
Position
complement(4325356..4326909)
AA seq 517 aa
MTKPEGPTNPQPSGGDPFGVEELRLTLDEAGICSWALDIPTGRVTVSPTCIRLFGVPPES
LTTFDAIQAVVHPDDRAARATAIGHALASGGSYEVDYRAVHPDGGVHWLRSRGRVKVGPD
GRPCRHRGVVFSIDEQRQFNEELRAREAHLRSILETVPDAMVVIDEQARIKSFSAAAVRQ
FGYAPDEVAGRNVSMLMPEPYRTQHDAYMARYLATGERRIIGIGRVVVGQRKDGSTFPME
LSVGEMRSGGERYFTGFIRDLTERKQTETRLQELQSELVHMSRFTALGEMASTLAHEINQ
PLTAIASYLKGCRRILGRMQGAEVPVLSDAVNQAAEQALRAGQVIRHLREFVARGESERH
IEGLPKLIEEASALALVGAKEKGVRVRFDLDPDAPLVLADRIQVQQVLLNLIRNAIEAMQ
EAPRRELVVATRAVAAEGLVEVSVADTGSGIAPEVAAQLFQPFVTTKANGMGVGLSICRT
IVEAHGGKILAEQGPAGGTTFRFTLRTFDRKELAHAH
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgacgaagcccgaaggcccgaccaacccgcagccgagcggcggggaccccttcggcgtc
gaggagctcaggctgacgctcgacgaggcaggcatctgcagctgggcgctggacatcccg
accggccgcgtcacggtctcgcccacctgcatccggctcttcggtgttccgccggaaagc
ctgaccaccttcgacgccatccaagcggtcgtgcacccggacgaccgcgcggccagggcg
acggccatcgggcacgccttggcgagtggtggaagctacgaggtcgactaccgcgcggtg
caccccgacggaggggtccattggctgcgctcgcgcgggcgggtcaaggtcggaccggac
ggccggccgtgccgtcaccggggcgtggtcttcagcatcgacgagcagcggcagttcaac
gaggagctgcgagcccgcgaggcgcatctgcgctcgatcctcgaaaccgttcccgacgcc
atggtggtcatcgacgagcaagcgcggatcaagtcgttcagcgccgccgcggtgcgccag
ttcggctacgcgccggacgaggtcgcgggccgcaacgtcagcatgctgatgccggagccc
taccgcacccagcacgacgcttacatggcccgctacctcgcgacgggggagcggcgcatc
atcggcatcggccgggtcgtcgtcggccagcgcaaggacggatcgaccttcccgatggaa
ttgtcggtcggcgagatgcgctcgggcggcgagcgctacttcacgggcttcatccgggac
ctgaccgagcggaagcagaccgagacgcgcctgcaggagctgcagtccgagctggtgcac
atgtcgcgcttcacggcgctcggcgagatggcctcgacgctcgcccacgagatcaaccag
ccgctgaccgccatcgcgagctacctgaaggggtgccggcgcatcctcggccggatgcag
ggagccgaggtcccggtgctctcggatgcggtgaaccaagccgccgagcaggcgctgcgg
gcggggcaggtcatccgtcacctgcgcgaattcgtggcccgcggcgagagcgagcgccac
atagagggcttgcccaagctcatcgaggaggcgagcgcgctggccctcgtcggcgccaag
gagaagggcgtgcgcgtgcgcttcgacctcgacccggacgcgcccctcgtgctggcggac
cgcatccaggtgcagcaggtgctgctcaacctgatccgcaacgcgatcgaggccatgcag
gaggcgccgcgtcgcgagctcgtcgtcgcgacgagggccgtcgcggcggaagggctcgtg
gaggtgagcgtggccgataccggcagcggcatcgcgccggaggtggcggcccagctgttc
cagcccttcgtgacgacgaaggcgaacgggatgggggtcggcctctcgatctgccgtacc
atcgtggaagcccatggcggcaaaatcctggccgagcagggtcccgcgggcggcacgacc
ttccggttcaccttgcgcaccttcgaccgaaaggagctcgctcatgcccactga

DBGET integrated database retrieval system