KEGG   Methylobacterium sp. 17Sr1-43: DK427_17155
Entry
DK427_17155       CDS       T05919                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti00220  Arginine biosynthesis
meti00250  Alanine, aspartate and glutamate metabolism
meti00471  D-Glutamine and D-glutamate metabolism
meti01100  Metabolic pathways
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DK427_17155
   00220 Arginine biosynthesis
    DK427_17155
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DK427_17155
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_17155
Enzymes [BR:meti01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     DK427_17155
SSDB
Motif
Pfam: Glutaminase
Other DBs
NCBI-ProteinID: AWN37240
UniProt: A0A2U8VV46
LinkDB
Position
3667303..3668244
AA seq 313 aa
MSHTAAELDGAVREIAEEMRERPDRGTVADYIPELATVDPRRFGLVVIDAAGHVAAGGDA
DMPFSIQSISKVFTLTLALGMVGDRLWRRVGREPSGSPFNSIVQLERERGIPRNPFINAG
AIAVTDVILSGHQPREALGEILRFMQFLGQDASIVIDEAVAASEQRTGFRNTALANYMKS
FGVLDNPVVYTLGVYFHHCAIAMSCRQLATAGRFLAHSGMNPATGHSVVSPERARRINAI
MLTCGHYDGSGEFAYRVGLPGKSGVGGGILAVAPGKASIAVWSPGLDAAGNSHLGRIALE
ALTRRMGWSIFGV
NT seq 942 nt   +upstreamnt  +downstreamnt
atgagccacacagccgccgaactcgacggcgccgtccgggagatcgccgaggagatgcgg
gagcggcccgaccggggcacggtcgccgactacatcccggaactcgccaccgtcgatccg
cgccgcttcggcctcgtggtgatcgacgccgccggccacgtcgcggcaggcggcgacgcg
gacatgcccttctcgatccagagcatctcgaaggtcttcaccctgacgctggcgctgggc
atggtcggcgaccggctctggcggcgggtcgggcgcgagccctcgggcagccccttcaac
tcgatcgtgcagctggagcgcgagcgcggcatcccgcgcaaccccttcatcaacgcgggc
gcgatcgcggtcaccgacgtgatcctgtccggccatcagccgcgggaggcgctcggcgag
atcctgcgcttcatgcagttcctggggcaggacgcctccatcgtcatcgacgaggcggtg
gcggcctccgagcagcgcacggggttccgcaacacggcgctggcgaactacatgaagtcc
ttcggcgtgcttgacaatccggtggtctacacgctcggcgtctacttccaccactgcgcc
atcgcgatgtcgtgccgccagctcgccaccgccgggcggttcctggcccattcggggatg
aacccggccaccggccactcggtggtctcgccggagcgggcgcgccgcatcaacgcgatc
atgctgacctgcggccactacgacggctcgggcgagttcgcctaccgggtcggcctgccc
ggcaagagcggcgtggggggcggcatcctggcggtcgcccccggcaaggcctcgatcgcg
gtctggtcgccgggcctcgacgccgccggcaactcgcatctcggccgcatcgcgctggag
gcgctcacccggcgcatgggctggtcgatcttcggagtgtga

DBGET integrated database retrieval system