KEGG   Methylobacterium sp. 17Sr1-43: DK427_17755
Entry
DK427_17755       CDS       T05919                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti00790  Folate biosynthesis
meti01100  Metabolic pathways
meti02020  Two-component system
Module
meti_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:meti00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DK427_17755
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_17755
Enzymes [BR:meti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     DK427_17755
SSDB
Motif
Pfam: PhoD PhoD_N
Other DBs
NCBI-ProteinID: AWN37340
UniProt: A0A2U8VVF9
LinkDB
Position
3800573..3802126
AA seq 517 aa
MSPPLTRRRVLTGAAALTLARPGISRAADRPALSHGLQSGDVSGSEAVVWARADRPSRAV
IEWATTERFTEIGGGVFVDALPESDLTVKTVLQGLPPDQDIHYRVRLQNLAEPTILGEPL
TGRFRSAPAQGRDVSFCWSGDTAGQGWGIDESRGGMTIYAAMLRNRPDFFLHSGDTIYAD
GPIQAEVRLPDGGLWRNIVTEEKAKPAETLAEFRGAYKYNLLDRNVLAMNREIPILAQWD
DHEVTNNWWPGEPLTRAEHRRRGYTAANSLVLAARATRAFHEYMPMRFEPAEPGRVYRRV
SYGPHLDVFLLDMRSYRGPNGANDETEPSARTQFLGPAQLTWLKRELKASRATWKAIAAD
MPLGLIVTYDTDRRFGSEAVAQGDGLPLGRELEIADLLRFIRDQDIRNTVWFTADVHYTA
AHHYDPNRAHFQEFAPFWEFVSGPLHAGTFGPAKLDDTFGPQLRFVKAPPAGRQNLSPAE
GYQFFGHVAIAGATGQMTVTLKDAADADLWRTVLDPA
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgtcccctcccctcacccgccgccgcgtcctcacgggcgccgccgccctcaccctggcc
cgccccgggatcagccgcgccgccgaccggcccgcgctcagccacggcctgcaatcgggc
gacgtctcgggcagcgaggcggtggtctgggcccgggccgaccggccgtcccgcgcggtg
atcgagtgggcgacgaccgagcgcttcaccgagatcggcggcggcgtcttcgtcgatgcc
ctgccggagagcgacctcacggtgaagacggttctgcagggcctgccgccggaccaggac
atccattaccgggtgcggctccagaacctcgccgagccgacgatcctgggcgagccgctc
accggccgcttccgcagcgcgccggctcaagggcgcgacgtcagcttctgctggtcgggc
gacaccgccggccagggctggggcatcgacgaatcccgcggcggcatgacgatctacgcc
gcgatgctgcggaaccgccccgacttcttcctgcattccggcgacacgatctacgccgac
gggccgatccaggccgaggtccggctccccgacggtggcctctggcgcaacatcgtcacc
gaggagaaggccaagcccgccgagacgctggccgagttccgcggcgcctacaagtacaat
ctcctcgaccgcaacgtgctcgcgatgaaccgcgagatcccgatcctcgcccagtgggac
gaccacgaggtcacgaacaactggtggccgggcgagccgctgacccgggccgagcaccgc
cgccgcggctacacggcggccaacagcctcgtgctcgccgcgcgcgccacccgcgccttc
cacgagtacatgccgatgcgcttcgagccggccgagccggggcgcgtctaccgccgggtc
tcgtacggaccccatctcgacgtgttcctgctcgacatgcgcagctatcgcgggcccaac
ggcgccaacgacgaaaccgagccgagcgcgcgcacgcagttcctcgggcccgcgcagctc
acttggctgaagcgggagctgaaggcctcccgcgcgacctggaaggcgatcgccgccgac
atgccgctcgggctgatcgtcacctacgacaccgaccggaggttcggctcggaggcggtg
gcgcagggcgacgggcttccgctcgggcgggagctggagatcgcggacctgctgcgcttc
atccgcgaccaggacatccgcaacacggtctggttcaccgcggacgtgcactacacggcg
gcgcaccactacgacccgaaccgggcccacttccaagagttcgcgccgttctgggagttc
gtctcgggcccgctccacgccggcaccttcgggccggccaagctcgacgacacgttcggc
ccgcagctgcgcttcgtgaaggcaccgccggcggggcgccagaacctctcgccggccgag
ggctaccagttcttcggccacgtcgcgatcgcgggcgccacggggcagatgaccgtgacg
ctgaaggacgcggccgacgcggatctgtggcggacggtgctcgacccggcatga

DBGET integrated database retrieval system