KEGG   Methylobacterium sp. 17Sr1-43: DK427_17870
Entry
DK427_17870       CDS       T05919                                 

Definition
(GenBank) light-harvesting protein
  KO
K08926  light-harvesting complex 1 alpha chain
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_17870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:meti00194]
    DK427_17870
Photosynthesis proteins [BR:meti00194]
 Anoxygenic photosystem
  Purple bacteria - Photosystem II related [OT]
   RC-LH1 complex
    DK427_17870
SSDB
Motif
Pfam: LHC
Other DBs
NCBI-ProteinID: AWN37360
UniProt: A0A2U8VVI2
LinkDB
Position
complement(3829309..3829491)
AA seq 60 aa
MHKIWLLFDPRRTLVALFTFLFVLALLIHFILLSTDRFNWLEGPKRSAQAQSLVLPQMPA
NT seq 183 nt   +upstreamnt  +downstreamnt
gtgcacaagatctggctcctgttcgatccgcgccggacgctggtggctctgttcaccttc
ctgttcgtgctggcgctgctgatccacttcatcctgctctcgacggaccggttcaactgg
ctggaggggcccaagcgctccgcccaggcgcagagcctcgtcctgccgcagatgccggct
tga

DBGET integrated database retrieval system