KEGG   Methylobacterium sp. 17Sr1-43: DK427_19320
Entry
DK427_19320       CDS       T05919                                 

Definition
(GenBank) transcriptional regulator
  KO
K21603  two-component system, OmpR family, flagellar system response regulator FtcR
Organism
meti  Methylobacterium sp. 17Sr1-43
Brite
KEGG Orthology (KO) [BR:meti00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:meti02022]
    DK427_19320
Two-component system [BR:meti02022]
 OmpR family
  Unclassified
   DK427_19320
SSDB
Motif
Pfam: Trans_reg_C Response_reg
Other DBs
NCBI-ProteinID: AWN37610
UniProt: A0A2U8VWD4
LinkDB
Position
4105033..4105725
AA seq 230 aa
MYCLVDARESVNAGYAASFDREGVSAFGLSPEEFTGWLQTASRGDLDAVQGFLLGDFEDR
AKCAGIIRKHSRAPIIALADQRSLEQTLVLFDAGIDDVLPKPVHVREILARSEAIWRRVN
GGVLPAAPGAEAPARPERLRVFFDGRDPEVDGEPLPLPRRERHILEYLVRNRGRRLTKAQ
VFNVIYGVYSNGVEESVVEGHVSKLRKKLSQRLGYDPIEAKRYMGYVYVG
NT seq 693 nt   +upstreamnt  +downstreamnt
atgtactgcttggtggatgccagggaatcggtgaacgccggttacgcggcgagcttcgac
cgcgagggggtgtcggccttcgggctctcgccggaggagttcaccggctggctgcagacc
gcctcgcgcggcgacctcgacgcggtccagggcttcctgctcggcgatttcgaggaccgg
gcgaaatgcgccgggatcatccgcaagcactcccgcgcgccgatcatcgcgctcgccgac
cagcgctccctggaacagaccctcgtcctgttcgacgccggcatcgacgacgtgctcccc
aagcccgtgcacgtgcgcgagatcctggcccgctcggaggcgatctggcgccgggtgaac
ggcggcgtgcttccggcggcgccgggcgccgaggccccggcccggccggagcgcctgcgg
gtgttcttcgacgggcgcgacccggaggtggacggcgagcccctgcccctgcccaggcgc
gagcggcacatcctcgaatacctcgtgcgcaaccgcggccggcggctgaccaaggcgcag
gtcttcaacgtgatctacggcgtctacagcaacggcgtcgaggagagcgtggtcgagggc
cacgtgagcaagctgcgcaagaagctcagccagcgcctcggctacgacccgatcgaggcc
aagcgctacatgggctacgtctacgtcgggtag

DBGET integrated database retrieval system