KEGG   Methylobacterium sp. 17Sr1-43: DK427_20265
Entry
DK427_20265       CDS       T05919                                 

Gene name
fixJ
Definition
(GenBank) DNA-binding response regulator
  KO
K14987  two-component system, LuxR family, response regulator FixJ
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_20265 (fixJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:meti02022]
    DK427_20265 (fixJ)
Two-component system [BR:meti02022]
 LuxR family
  FixL-FixJ (nitrogen fixation)
   DK427_20265 (fixJ)
SSDB
Motif
Pfam: Response_reg GerE Sigma70_r4_2 Sigma70_r4 FleQ
Other DBs
NCBI-ProteinID: AWN37775
UniProt: A0A2U8VVM4
LinkDB
Position
complement(4324746..4325366)
AA seq 206 aa
MPTDALVHVVDDDLAVRQSLAFLLASDGLAVRVHESASAFLAAVSDPGGCIVTDVRMPEV
DGIEFLRRLRKRGPMPPVIVMTGHADVPLAVEAMRAGAIDFIEKPFDDEVLLASVRSALA
QVERNASLAAESNAVRARLAALSERERQVLDGLVGGKANKVIGHDLGISPRTVEIYRANV
MSKLQAGSLSELVRMALVAGHLHGGR
NT seq 621 nt   +upstreamnt  +downstreamnt
atgcccactgacgcgctcgtgcatgtcgttgacgacgacctggcggtgcggcagtcgctt
gccttcctgctggccagcgacgggctagcggtccgcgtgcacgagtccgcgagcgccttc
ctcgccgccgtctccgaccccggcggctgcatcgtcacggacgtgcgcatgcccgaggtc
gacggcatcgagttcctgcgccgtctccgcaagagggggccgatgccacccgtcatcgtc
atgacgggccatgcggacgtgccgctcgccgtcgaggccatgcgggcgggcgccatcgac
ttcatcgagaagccgttcgacgacgaggtgcttctcgccagcgtcaggtcggccctggcg
caggtggagcggaacgcgagcctcgccgccgagagcaacgcggtgcgggcacgcctggcc
gccctctccgagcgcgagcgccaagtgctggacgggctggtcggcggcaaggccaacaag
gtcatcggccacgatctcggcatcagcccgcggacggtcgagatctacagggccaacgtc
atgtcgaagctgcaggcgggcagcctgtccgaactcgtccggatggccctcgtcgcggga
cacctgcacggcggacgttga

DBGET integrated database retrieval system