KEGG   Methylobacterium sp. 17Sr1-43: DK427_20335
Entry
DK427_20335       CDS       T05919                                 

Gene name
ccoN
Definition
(GenBank) cytochrome-c oxidase, cbb3-type subunit I
  KO
K00404  cytochrome c oxidase cbb3-type subunit I [EC:7.1.1.9]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti00190  Oxidative phosphorylation
meti01100  Metabolic pathways
meti02020  Two-component system
Module
meti_M00156  Cytochrome c oxidase, cbb3-type
Brite
KEGG Orthology (KO) [BR:meti00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DK427_20335 (ccoN)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_20335 (ccoN)
Enzymes [BR:meti01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.9  cytochrome-c oxidase
     DK427_20335 (ccoN)
SSDB
Motif
Pfam: COX1
Other DBs
NCBI-ProteinID: AWN37787
UniProt: A0A2U8VVL0
LinkDB
Position
complement(4341048..4342727)
AA seq 559 aa
MAATPSSKYMTEGEVGLGLSLLVGALLCGVASSRAVDAPFGAHMAVFALAAIAGIVAILK
RYEGRPDEAPPQMIGGKPNYNLGPVKFTAIAAMVWGIAGFLVGCIIAFQLWAPALNLGLE
YASFGRLRPLHTSAVIFAFGGNVLIGTSLYVVQRTCRARLAGELAPWFVVLGYNLFIVIA
GTGYLMGVTQSKEYAEPEWYADLWLTIVWVAYLLVFLATLWKRKEPHIFVANWFYLAFIV
TIAMLHVVNNLAMPVTVFGSKSYPIFAGVQDALIQWWYGHNAVGFFLTAGFLAIMYYFVP
KRAERPIYSYRLSIIHFWALIFMYIWAGPHHLHYTALPDWAQTLGMTFSIMLWMPSWGGM
INGLMTLSGAWDKLRTDPVLRFMVVSLAFYGMATFEGPMMSIKAVNSLSHYTDWTIGHVH
SGALGWVAYISFGALYCLVPWLWNRREVYSLKLVEWHFWVSTLGIVLYITSMWVAGIMQG
LMWRAYNALGFLEYSFVETVEAMQPYYLVRALGGVLFLIGGLIMAYNLAMTIAGKTASES
EAPPAGEALPATVGLAPAE
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggccgcgacaccatcatcgaagtacatgacggagggggaggtgggcttaggcctctcc
ttgctcgtcggcgcgctcctctgtggcgtcgcatcctcgcgggcggtcgacgccccgttc
ggcgcccatatggccgtcttcgcgctcgccgcgatcgcaggcatcgtcgccatcctcaag
cgctacgagggccgccccgacgaggctccgccgcagatgatcgggggcaagccgaactac
aacctcggacccgtgaagttcacggccatcgccgcgatggtctggggcatcgccggcttc
ctcgtcggctgcatcatcgccttccagctctgggcgcccgcgctcaacctcggcctggag
tacgcaagcttcggccgcctgcgcccgctccatacctcggcggtgatcttcgccttcggc
ggcaacgtcctgattggaacctcgctctacgtcgtccagcgcacctgccgcgcccggctc
gcgggcgagctcgcgccctggttcgtggtgctcggctacaacctgttcatcgtcatcgcc
ggcaccggctacctcatgggcgtgacccaatccaaggagtacgccgagcccgagtggtac
gccgacctctggctcaccatcgtctgggtcgcgtacctgctggtgttcctcgcaaccctc
tggaagcgcaaggaaccgcacatcttcgtggcgaactggttctacctcgccttcatcgtg
accatcgccatgctgcacgtcgtcaacaacctggcgatgccggtcacggtgttcggctcg
aagtcctatcccatcttcgcgggcgtgcaggacgcgctgatccagtggtggtacggccac
aacgcggtcggctttttcctcaccgccggcttcctggcgatcatgtactacttcgttccg
aagcgcgctgagcggccgatctactcctaccgcctgtcgatcatccacttctgggcgctg
atcttcatgtatatctgggcgggcccgcaccacctgcactacacggcactgccggactgg
gcgcagacgcttggcatgaccttctcgatcatgctgtggatgccctcctggggcgggatg
atcaacggcctgatgaccctctcgggggcctgggacaagctccgcaccgacccggtcctg
cgcttcatggtcgtgtcgctggccttctacggcatggcgaccttcgaggggccgatgatg
tcgatcaaggccgtgaactccctctcgcactacacggactggaccatcggccacgtgcat
tcgggggcactcggatgggtcgcctacatctccttcggcgcgttgtactgcctcgtgccc
tggctatggaaccggcgtgaggtctactcgctcaagctcgtcgagtggcacttctgggtc
tcgacgctcggcatcgtactgtacatcacctcgatgtgggtcgccgggatcatgcagggc
ctgatgtggcgtgcctataatgccctgggtttcctcgagtactccttcgtcgaaaccgtc
gaggcgatgcagccctactatctcgtccgggcgctcggcggggtgctgttcctgatcggc
gggctgatcatggcctacaacctcgccatgaccatcgcgggcaagaccgcctccgagagc
gaggccccgccggcaggagaggcgctccctgcgaccgtcggcctcgccccggccgagtga

DBGET integrated database retrieval system