KEGG   Methylobacterium sp. 17Sr1-43: DK427_20700Help
Entry
DK427_20700       CDS       T05919                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti00473  D-Alanine metabolism
meti00550  Peptidoglycan biosynthesis
meti01100  Metabolic pathways
meti01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:meti00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DK427_20700
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DK427_20700
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DK427_20700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:meti01011]
    DK427_20700
Enzymes [BR:meti01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DK427_20700
Peptidoglycan biosynthesis and degradation proteins [BR:meti01011]
 Precursor biosynthesis
  Amino acid ligase
   DK427_20700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AWN37852
UniProt: A0A2U8VX73
LinkDB All DBs
Position
complement(4416134..4417057)
Genome map
AA seq 307 aa AA seqDB search
MPKHVAVLMGGTSSERVISLKTGTACADALEGEGYRVTRVDVGADVAAVLADLRPDAAFN
ALHGPAGEDGTIQGLLEILKIPYTHSGVLASALAMHKERAKVVMRAAGVSVPEGRVVNRH
VAAKSHPLPPPYVVKPVSEGSSVGVIIVRDGRSHPPQILASEEWTYGEEVLAETYVAGRE
LTCAVMGDRALGVIEIKPASGEWYDFDAKYAEGGSIHVLPAELKPNVYQRVQELALTAHQ
ALGCRGVSRADLRYDDTPGGTGALVVLEVNTQPGMTQTSLVPELAAHAGYGFGELVRWMV
EDASLGR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagcacgtcgccgtcctcatgggaggcacctccagcgagcgcgtcatctcgctc
aagaccggcaccgcctgcgcggacgcgctggagggcgagggctaccgggtgacccgcgtc
gacgtcggggccgacgtcgcggcggtgctggccgacctccggcccgacgccgccttcaac
gcgctgcacggcccggctggcgaggacggcacgatccagggcctcctggagatcctgaag
atcccctacacgcattccggcgtgctcgcctcggcgctcgccatgcacaaggagcgtgcc
aaagtggtcatgcgggcggccggggtttccgtgccggagggccgcgtcgttaaccgtcac
gtggccgcgaagtcacaccctttgccgcctccctacgtcgtgaagccggtctcggagggc
tcctcggtcggtgtcatcatagtgcgcgacgggcgctcgcacccgccccagatcctggcc
tcggaggagtggacctacggcgaggaagtccttgcggagacttacgttgcgggccgcgag
ctgacctgcgcggtgatgggcgaccgggcgctcggcgtcatcgagatcaagcccgcatcg
ggcgagtggtacgacttcgacgccaagtacgccgagggtggctcgatccacgtcctgccc
gcggagcttaaaccaaatgtttaccagcgtgtccaagagttggcgttaacggcgcatcaa
gcactgggctgccggggcgtcagccgtgcggaccttcgctacgacgatacaccgggaggc
accggtgccctcgtcgtgctcgaggtcaacacgcaacccggcatgacccagacgagcctt
gtgccggagttggcggcccatgcgggctacggattcggtgagctcgtccgatggatggtg
gaggacgcttctctgggccgctga

DBGET integrated database retrieval system