KEGG   Methylobacterium sp. 17Sr1-43: DK427_21070
Entry
DK427_21070       CDS       T05919                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00247  fumarate reductase subunit D
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti00020  Citrate cycle (TCA cycle)
meti00190  Oxidative phosphorylation
meti00620  Pyruvate metabolism
meti00650  Butanoate metabolism
meti01100  Metabolic pathways
meti01110  Biosynthesis of secondary metabolites
meti01120  Microbial metabolism in diverse environments
meti01200  Carbon metabolism
meti02020  Two-component system
Module
meti_M00009  Citrate cycle (TCA cycle, Krebs cycle)
meti_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
meti_M00150  Fumarate reductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:meti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DK427_21070
   00620 Pyruvate metabolism
    DK427_21070
   00650 Butanoate metabolism
    DK427_21070
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DK427_21070
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_21070
SSDB
Motif
Pfam: Sdh_cyt COX4_pro_2
Other DBs
NCBI-ProteinID: AWN39147
UniProt: A0A2U8VZC1
LinkDB
Position
4497846..4498223
AA seq 125 aa
MRTTARSAIAPGITHAPHRRPGFAAALIHRLSGIALALFLPMHFIALGTALQGADRLESF
LGLTHNGFVRVAEWGLVCALAVHMALGLRVLAIEWLSYRERTAVVVSGCLATAFAVGLLF
LLSGA
NT seq 378 nt   +upstreamnt  +downstreamnt
atgagaaccaccgcacgatccgccatcgctcccggcatcacgcacgccccccatcgccgc
cccggcttcgccgccgcgctgatccaccggctctctggcatcgcgctggcgctgttcctg
ccgatgcacttcatcgcgctcggcaccgcgctgcagggcgccgaccggctcgagagcttc
ctcgggctcacccataacggcttcgtgcgcgtggccgagtggggtctcgtctgcgcgctg
gccgtccacatggcgctgggcctgcgcgtgctggcgatcgagtggctgagctaccgcgag
cgcaccgccgtggtcgtctccggctgcctcgcgaccgccttcgcggtcggcctcctcttt
ctcctcagcggggcctga

DBGET integrated database retrieval system