KEGG   Methylobacterium sp. 17Sr1-43: DK427_21115
Entry
DK427_21115       CDS       T05919                                 

Gene name
kdpB
Definition
(GenBank) K(+)-transporting ATPase subunit B
  KO
K01547  potassium-transporting ATPase ATP-binding subunit [EC:7.2.2.6]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_21115 (kdpB)
Enzymes [BR:meti01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.6  P-type K+ transporter
     DK427_21115 (kdpB)
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase HAD Hydrolase_3 CBS
Other DBs
NCBI-ProteinID: AWN37923
UniProt: A0A2U8VVT1
LinkDB
Position
4507337..4509427
AA seq 696 aa
MSRKTSSRLSAALIVPALVGSVRKLDPRAMIRNPVMFVVEVVAALTTVLFLRDLVTGGTD
LLFSGQIILWLWFTLLFANFAEALAEGRGKAQADSLRRTRTEMTAKRLGGQGYAYDTVPG
TSLKVGDIVLVEAGDLIPSDGEVIAGVASVNEAAITGESAPVIRESGGDRSAVTGGTQVL
SDAIKVRITAAAGATFVDRMIALVEGASRRKTPNEIALNILLAGLTIVFVFAVATIPSFA
RYAGGSIPVIVLVALFVTLIPTTIGALLSAIGIAGMDRLVRFNVLAMSGRAVEAAGDVDT
LLLDKTGTITLGNRQAIAFQPVRGVTEQELADAAQLASLADETPEGRSIVVLAKETYGIR
ARDMAGLNASFVPFTAQSRMSGVDLDGSSIRKGAVDAVIAAVSGQPMASRGSSAALAYHP
AAETEVVGEIRAIAEEIATAGGTPLAVAKNGRLLGVVTLKDIVKGGIAERFAELRRMGIR
TVMITGDNPMTAAAIAAEAGVDDFLAQATPEDKLALIRKEQAQGKLVAMCGDGTNDAPAL
AQADVGVAMNTGTVAAREAGNMVDLDSDPTKLIEIVGIGKQLLMTRGALTTFSIANDVAK
YFAIIPAMFIALYPQLQALNVMGLSSPQSAILSAIIFNALIIVALIPLALKGVTYQAVGA
ASLLRRNLLVYGLGGVLVPFVAIKAIDMAVTALHLA
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgtcccgcaagacctcatcgcgcctcagcgcagccctgatcgtgcccgcgctcgtgggc
tccgtgcggaagctcgacccccgcgccatgatccgcaacccggtcatgttcgtggtcgag
gtcgtggccgccctgacgaccgtgctgttcctccgcgacctcgtgaccggcggcaccgac
ctgctcttctccggccagatcatcctctggctctggttcacgctgctgttcgccaacttc
gcggaggcgctggcggagggccgcggcaaggcccaggccgattccctgcgccgcacccgc
accgagatgacggccaagcgcctcggcggccagggctacgcctacgatacggtgccgggc
acgagcctcaaggtcggcgacatcgtcctggtagaagccggcgacctgatcccctccgac
ggcgaggttatcgcgggcgtggcctcggtcaacgaggcggcgatcacgggcgaatccgcg
cccgtcatccgcgagtcgggcggcgaccgctcggccgtgaccggcggcacccaggtactc
tccgacgcgatcaaggtccgcatcacggcggccgccggcgcgaccttcgtcgaccgcatg
atcgccctcgtggagggcgcgtcgcgccggaagacccccaacgagatcgcgctgaacatc
ctgctcgcgggcctcaccatcgtgttcgtcttcgcggtggcgaccatcccgagctttgcg
cgctacgccggcggctccatcccggtcatcgtgctggtcgccctcttcgtgacgctgatc
cccaccaccatcggcgcgctgctctcggccatcggcatcgccggcatggaccgtctggtc
cgcttcaacgtgctggccatgtcgggccgcgccgtggaggcggccggcgacgtcgacacg
ctgctcctcgacaagaccggcacgatcacgctcggcaaccggcaggcgatcgcgttccag
ccggtccgcggcgtcaccgagcaggaactcgccgatgcggcccagctcgcctcgctcgcc
gacgagacgccggaagggcgctccatcgtggtgctcgccaaggagacctacggcatccgc
gcgcgcgacatggcggggctgaacgcctccttcgtgcccttcaccgcgcagtcgcgcatg
tcgggcgtcgatctcgacggctcgtccatccgcaagggcgcggtcgacgcggtcattgcc
gcggtctccgggcagccgatggccagccgcggctccagcgcggcgctcgcctaccacccg
gccgccgagaccgaggtggtgggcgagatccgcgccatcgccgaggagattgccacggcc
ggcggcacgccgctcgctgtggcgaagaatgggcgcctgctcggcgtggtcaccctgaag
gacatcgtgaagggcggcatcgccgagcgcttcgcggaactgcgccggatgggcatccgc
acggtcatgatcaccggcgacaacccgatgacggcggccgccatcgccgccgaggccggg
gtggatgatttcctggcccaggcaaccccggaggacaagctggcgctcatccgcaaggag
caggctcagggcaagctggtggccatgtgcggcgacggcaccaacgatgcgcccgcgctc
gctcaggccgatgtgggcgtcgccatgaacaccggcacggtcgctgcccgcgaggccggc
aacatggtcgacctcgacagcgacccgaccaagctcatcgagattgtcggcatcggcaag
cagctgctgatgacgcgcggggcgctgaccacattctccatcgccaacgacgtggcgaag
tacttcgccatcatcccggcgatgttcatcgcgctctacccgcaactgcaggcgctcaac
gtgatggggctgtcctcgccgcagagcgcgatcctgtcggccatcatcttcaacgcactg
atcatcgtcgcgctgatcccgctggccctcaagggcgtgacctaccaggcggtcggggcg
gcctcgctgctgcgccgcaacctgctcgtctacggcctcggcggcgtcctggtgccgttc
gtagccatcaaggccatcgacatggccgtcaccgccctccacctcgcctga

DBGET integrated database retrieval system