KEGG   Methylobacterium sp. 17Sr1-43: DK427_21120
Entry
DK427_21120       CDS       T05919                                 

Definition
(GenBank) potassium-transporting ATPase subunit C
  KO
K01548  potassium-transporting ATPase KdpC subunit
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_21120
SSDB
Motif
Pfam: KdpC
Other DBs
NCBI-ProteinID: AWN37924
UniProt: A0A2U8VVT5
LinkDB
Position
4509453..4510058
AA seq 201 aa
MLNQLRPALVLLVALTAATGLAYPLAVTGIAGAVFPAKAAGSLILRDGRVVGSSLIGQSF
TGAGYFHGRPSATTAADPADATRTVPAPYNAANSMGSNLGPTSAALAERVKGGLDALKAE
NPNAPVPVDLVTASGSGLDPDISPDAALFQVPRVAKARNLPEDRLRDLVTANVEGRTVGL
LGEPRVNVLALNLALDDLAKH
NT seq 606 nt   +upstreamnt  +downstreamnt
atgctgaaccagcttcgtcccgccctcgtcctgctcgtcgcgctgacggcggccacgggt
ctcgcctacccgctggccgtgaccggcatcgcgggcgccgtcttccccgccaaggctgcc
ggcagcctgatcctgcgcgacggcagggtcgtcggctccagcctcatcggccagagcttc
accggcgccggctatttccacggccggccctcggcgacgaccgccgccgacccggccgac
gccacgaggacggtgccggcgccctacaacgcggcgaactccatgggctccaacctcggg
ccgacgagcgcggcgctggccgagcgggtcaaaggcggtctcgatgcgctgaaggcggag
aacccgaacgcgccggtgccggtcgatctcgtcaccgcgagcggctcgggcctcgatccc
gacatctcgcccgacgccgccctgttccaggtcccgcgcgttgccaaggcccgcaacctg
cccgaggacaggctgcgcgacctcgtgacggcgaatgtcgaggggcgcaccgtgggcctg
ctgggcgagccccgcgtcaacgtgctggcgctcaaccttgccctggacgacctcgccaag
cactga

DBGET integrated database retrieval system