KEGG   Methylobacterium sp. 17Sr1-43: DK427_23500
Entry
DK427_23500       CDS       T05919                                 

Definition
(GenBank) sensor histidine kinase
  KO
K10125  two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC:2.7.13.3]
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_23500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:meti01001]
    DK427_23500
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:meti02022]
    DK427_23500
Enzymes [BR:meti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     DK427_23500
Protein kinases [BR:meti01001]
 Histidine kinases
  NtrC family
   DK427_23500
Two-component system [BR:meti02022]
 NtrC family
  DctB-DctD (C4-dicarboxylate transport)
   DK427_23500
SSDB
Motif
Pfam: HATPase_c dCache_1 HisKA HATPase_c_5 HATPase_c_3
Other DBs
NCBI-ProteinID: AWN38340
UniProt: A0A2U8VYJ6
LinkDB
Position
complement(5008400..5010253)
AA seq 617 aa
MNVIASVARAVPRKLTGPGPVLRSIWLWRWILAAITLVATLVVFAFTLEAGLDLARRQAR
QRLVITEAVLRAAVNRYEYLPTVLALDTQVQALLEAVDAPDRIAAVNTKFEAVAATSNVS
AIYLLDADGLTRGASNWNRPLSFIGASYAYRPYFTAAKTTGVSRYFGVGTTTGLPGLFVG
KAVSGPDGRVVGIVVVKVDLEGLQGEWRAAGEQVLVSDAAGVVFLASEPAWKYRPFHPVG
VADAARIQAERQYGDSTLQPLLDGEQADLAGVIDLPVEGRTVSGLVERAAMPDLSWTVWY
VTPTGPALRQALLAALVAAIACLALAFALAARSQRQRRLQSERAMRLSLEQRVADRTQAL
SAANDRLRGEVAERERATAALRATQDELIHAGRLAALGQISTAINHEINQPLAALRTFLA
STAKFLERGDLATVERNLERMTQVTQRIGEIIRHLKAFARKTGPEHREPVSLQATAEAVL
DLLQARIRSEGVTVTCAIPAEAFVQAEPVRLEQVLLNLIVNALDAMRSTPERLLHLTGAR
EADGTWRLSVADSGGGIAKEHMGQVFDPFFTTKSAGEGLGLGLSLSSLIVRDLGGSIAAA
NDERGAVLAIVLPAAKG
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgaacgtcatagccagcgtcgcccgggcggttccgcgaaagctcaccgggccgggtccg
gtgctcaggtcgatctggctgtggcggtggatcttggcggccatcacgctcgtggctacc
ctcgtggtcttcgcgttcactctggaggcaggcctcgacctggcccgtcgccaagcgcgc
cagcgcctcgtcattaccgaggccgtgctgcgggcggccgtcaaccggtacgagtatctg
cccacggtcctcgccctcgacacgcaggtgcaggccctcctcgaagccgtcgatgcgccg
gaccgcatcgccgccgtcaacaccaagttcgaggccgtcgcggcgacctcgaacgtctcg
gccatctacctcctggatgccgacggcttgacgcgcggcgcgagcaactggaaccggccg
ctcagcttcatcggggcgtcctacgcctaccggccctacttcaccgcggccaagaccact
ggcgtctcacgctatttcggcgtcggcacgacaaccggccttcccggcctgttcgtcggc
aaggccgtttccggaccggacggccgggtcgtggggatcgtggttgtcaaggtcgatttg
gagggactgcagggtgagtggcgggcggccggcgagcaggtgctggtctcggacgccgcc
ggcgtggtcttcctcgcgagcgagccggcgtggaagtatcgcccgttccacccggtcggc
gtggccgatgcggcgcggatccaagccgagcgacaatacggcgacagtaccctgcagccc
cttctcgacggcgagcaggcggacctcgcgggcgtcattgatctgccggtcgagggccga
accgtcagcgggctcgtggagcgcgcggcgatgccggatctgtcctggacggtctggtac
gtgacgccgactggacccgccctgcgacaggccttgctcgcggccctggttgcggcgatc
gcctgcttggccctggctttcgccctggctgcccggagccagcggcaacgacggctgcag
agcgagcgggcgatgcgcctctccctggagcagcgcgtcgcggatcgtacccaggccctg
agcgccgccaacgaccgccttcgcggcgaggtcgcggagcgggagcgcgccaccgcggcg
ctacgggcgacccaggacgagctgatccatgccggccgcctcgccgcgctgggacagatc
tcgacggccatcaaccacgagatcaaccagccgctggcagccctgcgcaccttcctcgcc
agcacggcgaagttcctggaacgtggcgatctcgcgacggtggagcggaacctcgagcgg
atgacgcaggtgacgcagcgcatcggcgagatcatccgccacctgaaggccttcgcccgc
aagaccgggccggaacatcgtgagccggtaagcttgcaggcgacagcggaggccgtcctg
gatctgctccaggcccgcatccggtccgagggagtgaccgtcacctgcgcgatccccgcc
gaggccttcgtgcaggcggagccggttcgcttggagcaggtcctgctgaacctgatcgtc
aacgccctcgacgcgatgcggagcacgcccgagcgcctgcttcatttgaccggtgcgcgc
gaagcggatggcacctggcgcctcagcgtcgccgatagtggcggcgggattgcgaaggag
cacatggggcaggtcttcgatcccttcttcaccacgaagtcggccggcgagggcctcggc
ctcggcctatcgctgtcctcgctgatcgtgcgcgatctcggcggcagcatcgccgccgcc
aacgacgagcgcggcgcggtgctcgccatcgtcctacctgcggcgaaggggtaa

DBGET integrated database retrieval system