KEGG   Methylobacterium sp. 17Sr1-43: DK427_24345
Entry
DK427_24345       CDS       T05919                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
meti  Methylobacterium sp. 17Sr1-43
Brite
KEGG Orthology (KO) [BR:meti00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:meti02022]
    DK427_24345
Two-component system [BR:meti02022]
 OmpR family
  Unclassified
   DK427_24345
SSDB
Motif
Pfam: Response_reg Trans_reg_C
Other DBs
NCBI-ProteinID: AWN38473
UniProt: A0A2U8VXE5
LinkDB
Position
5190054..5190773
AA seq 239 aa
MRILIVEDDAALARGIVSSLRLSGFAVDHEPSGADVLPLLRHEAYALVLLDLGLPDRSGF
EVLREIRRAGLTVPVLIVTARSAVADRVAGLDLGADDYLAKPFDPAELEARVRALVRRGH
GRPDPIVTCADLVYDRSGQVATLAGRVLPLRKRELAILESLITRAGRVVSKERLVAEVFG
FDEEITPNAIEVYVARLRRHFGSTGPRIVTLRGLGYLMEAASAETGPEPGNETGAGEER
NT seq 720 nt   +upstreamnt  +downstreamnt
atgcggatcctcatcgtcgaggacgatgccgcgctcgcccgcggcatcgtctcgtcgctg
cggctcagcggcttcgccgtggaccacgagccgagcggggccgacgtgctgccactcctg
cgccatgaagcctacgccctggtcctgctcgatctcggcctgcccgaccgctccggcttc
gaggtgctgcgcgagatccggcgcgcgggcctcacggtgccggtgctgatcgtgaccgcg
cgctcggcggtcgcggaccgggtcgcggggctcgacctcggcgcggacgactacctcgcc
aagcccttcgatccggccgagctggaggcgcgggtgcgcgccctggtccgccgcggccac
ggcaggcccgacccgatcgtcacctgcgccgacctcgtctacgaccgctccgggcaggtg
gcgacgctggccggccgcgtcctgcccctgcgcaagcgcgagctcgccatcctcgaatcg
ctcatcacgcgggccgggcgggtcgtctcgaaagagcgcctcgtggccgaagtcttcggc
ttcgacgaggagatcacaccgaacgccatcgaggtctatgtcgcgcggctgcgccgccat
ttcggctccaccggccccaggatcgtgaccctgcgcggactcggctacctgatggaggcg
gccagcgccgagacgggtccagaacccggcaacgagaccggcgccggggaggaacggtga

DBGET integrated database retrieval system