KEGG   Methylobacterium sp. 17Sr1-43: DK427_24930
Entry
DK427_24930       CDS       T05919                                 

Definition
(GenBank) efflux RND transporter periplasmic adaptor subunit
  KO
K07799  membrane fusion protein, multidrug efflux system
Organism
meti  Methylobacterium sp. 17Sr1-43
Pathway
meti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meti00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK427_24930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:meti02000]
    DK427_24930
Transporters [BR:meti02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   DK427_24930
SSDB
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 DDRGK DUF5667
Other DBs
NCBI-ProteinID: AWN38571
UniProt: A0A2U8VYY0
LinkDB
Position
5314117..5315313
AA seq 398 aa
MRRSVRNLLIGLAVLAAAGGGWYAAGRPVPAPVAGLLGTGDRPAAERKDDKPLGVSMAEA
VSDSVPIAFTYTGTFVSPKDALLQARVTGVVTERPFEPGSHVKKGDVLFRIDKRPFEVAL
QTAKAQQEQAKAQLEFAQAEVARTNELASKGYASEQRAQQQQSQLETAAAGLQQAEAAIA
RQELNIAYAVVEAPFEGRASLSNVNVGDLVNENQTELVSVVQLDPIDLQMALSSEDVEAV
RQGLKEGTVTVGVLDGRGTKVADARIYQLDNRFDPRTARRLVRASVANADERFVPGQFMR
GRIQVGTQSRILVPTVALSAKLAQRIVYVVGKNGRVEQRPVETGQAYGERTEILKGLEAG
ERVVTDHIQRMRDGLRVEERRAVAGNEASTGIKGRPVQ
NT seq 1197 nt   +upstreamnt  +downstreamnt
gtgcgcaggagtgtgaggaacctgttgatcggcttggccgtgctcgccgccgcgggtggc
gggtggtacgcggccggccggcccgtgccggcccccgtagcaggccttctcggcacgggc
gatcggccggccgccgagcggaaggacgacaagccgctcggcgtgagcatggccgaggcg
gtctcggacagcgtgccgatcgccttcacgtatacggggaccttcgtctcgccgaaggac
gcgctgctccaggcgcgcgtgaccggcgtggtcacggagcggcccttcgagccgggctcg
cacgtcaagaagggcgacgtgctgttccggatcgacaagcggcccttcgaggtggcgctg
cagacggcgaaggcgcagcaggagcaggccaaggcccagctcgaattcgcgcaggccgag
gtcgcacgcaccaacgagctcgccagcaagggctacgcgagcgagcagcgcgcccagcag
cagcagtcgcagctcgagaccgccgccgcgggcctgcagcaggccgaggcggccatcgcc
cgccaggaactgaacatcgcctacgcggtggtcgaggcgccgttcgagggacgggcgagc
ctgagcaacgtgaacgtgggcgacctcgtcaacgagaaccagaccgaactcgtctcggtg
gtgcagctcgatccgatcgacctgcagatggccctgtcgtcggaggacgtggaggccgtg
cgccagggcctcaaggagggaacggtcaccgtcggcgtgctcgacgggcgcggcacgaag
gtcgcggacgccaggatctaccagctcgacaaccgcttcgacccgcgcacggcccggcgc
ctcgtgcgggcgagcgtggcgaacgcggacgagcgcttcgtcccgggccagttcatgcgc
ggccgcatccaggtcggcacacagtcccggatcctcgttcccacggtcgcgctctcggcc
aagctcgcgcagcggatcgtctacgtcgtcggcaagaacgggcgcgtggagcagcggccg
gtggagaccgggcaggcctatggcgagcggaccgagatcctgaaggggctggaggccgga
gagcgggtggtcacggatcacatccaacggatgcgcgacggtcttcgggtggaggagcgg
cgagcggtcgccggaaacgaggcgtcgaccgggatcaagggtcggccggtccagtga

DBGET integrated database retrieval system