KEGG   Methylomonas sp. LW13: U737_07935Help
Entry
U737_07935        CDS       T05879                                 

Definition
(GenBank) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
metl  Methylomonas sp. LW13
Pathway
metl00220  Arginine biosynthesis
metl01100  Metabolic pathways
metl01110  Biosynthesis of secondary metabolites
metl01210  2-Oxocarboxylic acid metabolism
metl01230  Biosynthesis of amino acids
Module
metl_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:metl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    U737_07935
Enzymes [BR:metl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     U737_07935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC GFO_IDH_MocA Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: QBC26840
LinkDB All DBs
Position
1744149..1745177
Genome map
AA seq 342 aa AA seqDB search
MIRAGIVGGTGYTGVELLRILVLHPQVEVSVVTSRADAGMRVDQLYPSLRGCCDVTFSLP
ELDNLKDCDVVFFATPNGTAMLMAKALVELGVKVIDLSADFRIKDRHEWEKWYGMQHASP
NLIAEAVYGLPEVNREQIKQARLIACPGCYPTAVQLGFLPLLEVGAIDQQYLIADVKSGV
SGAGRKAEISSLMSEAGESFKAYAVAGHRHLPEIRQGLQNVAKQAVGLTFVPHLTPMIRG
IHATLYGRLNRKLDLQSLFEEKYRDERFVDVLPSGSHADTRNVRGSNRCQIAVHQPQGGD
TVVILSVIDNLVKGASGQAVQNMNLMFGLPEYLSLETVALYP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgatacgtgcaggcattgtcggcggtaccgggtataccggcgtcgaattattaagaatt
ttggtattgcatccccaggtcgaagtgagtgtggtgacttcgcgcgcggatgccggaatg
cgagtggatcagttgtatccgagtctacggggctgctgtgatgtgacatttagcctgccg
gaactcgataatttaaaagactgcgatgtggtgtttttcgcaacgccaaacggtaccgcc
atgttgatggcaaaggcgctggtggaactgggtgtcaaagttatcgatttgtctgccgat
tttcggattaaagaccggcacgaatgggaaaagtggtatggcatgcagcacgccagcccg
aatctcatcgccgaggcggtttatggtttgccggaagtcaatcgggagcagatcaagcag
gcgcgattgattgcatgcccaggatgttatccgactgccgtgcaattggggtttttgccg
ttattggaggtcggagcgattgatcagcagtatttgatcgccgacgtgaaatccggcgtc
agcggtgcggggcgcaaggcggaaatctcgtcgttgatgagtgaggcaggtgagagtttt
aaggcttatgcagtcgccgggcacagacatttgccggaaatcaggcagggtttgcaaaat
gtcgccaaacaggcagttggtttaactttcgtgccgcatctgacgccgatgatacgcggt
attcacgccacgctgtatgggcgtttaaataggaagttggatttgcaaagtttgtttgaa
gagaagtatcgcgatgaaagatttgtcgatgtgttgccaagcggcagtcatgccgacact
cgcaacgtgcgcggcagtaatcgctgtcaaattgccgtgcatcaaccgcaaggcggtgat
acggtagtgattttgtctgtgattgataacttggtgaaaggcgcgtcggggcaggcggtg
caaaatatgaatctgatgttcgggctgcccgagtatctgtctttagagacggttgcttta
tatccttaa

DBGET integrated database retrieval system