KEGG   Methylomonas sp. LW13: U737_15755Help
Entry
U737_15755        CDS       T05879                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
metl  Methylomonas sp. LW13
Pathway
metl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
metl01100  Metabolic pathways
metl01110  Biosynthesis of secondary metabolites
metl01130  Biosynthesis of antibiotics
metl01230  Biosynthesis of amino acids
Module
metl_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:metl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    U737_15755
Enzymes [BR:metl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     U737_15755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: QBC28233
LinkDB All DBs
Position
complement(3457376..3458452)
Genome map
AA seq 358 aa AA seqDB search
MSVSFDIQSSIANYRVVIENGAFAEVQRQDENSAVLCDNFFETAFSGNAKVIAVPANEET
KSLTSVPEIIVKMRDLALTRQAKLTAVGGGSLQDIATFCASIYMRGIKWDYIPTTLLGMV
DSCIGGKSSINVGRYKNLVGNFHPPETIIIDPNLVKTLNSEQKIAGLCEAVKICYAKGSS
CFSEYMRLNPQMDMNVEGYADVIELSLKAKKWFIEIDEFDKAERLLLNFGHTFGHALEGA
SNFEVSHGIAVGLGMLIAINYAQVSGGLEHIPADTQQLKDYVIGLLDEIPMLKEIIQRID
VEKVFECFISDKKHSTSHFIIISVNGSGALERLFIDKTEANIINLKSAISSVISQSYK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtatcgtttgatattcaatccagtattgcaaattatcgcgtggtaatagaaaac
ggtgcttttgccgaagtacaacggcaagatgagaatagcgccgtgttatgcgataacttt
tttgaaacggctttttccgggaatgccaaggttattgcggtgccggcgaatgaagaaacc
aagagtttgacatccgtacccgagataatcgtaaaaatgcgagatttagccttaacaagg
caagctaaattgacggccgtcggtggcggtagcctgcaggatatagccaccttttgtgca
tcgatttatatgcgcggtatcaaatgggattatattcccaccactctattgggtatggtg
gattcttgtattgggggtaaatcatctatcaatgttggacgttataaaaatctggttgga
aacttccatcccccggaaaccattataattgatccgaatttagtaaaaaccctcaactca
gaacagaaaatcgccggattgtgcgaggccgtgaagatttgctatgccaaaggaagttcg
tgtttttctgagtatatgcggttaaatccgcaaatggatatgaatgtagaagggtatgcg
gacgtcattgaattaagtttaaaagcaaaaaaatggtttatcgaaattgatgaatttgat
aaggccgagcgtttattactgaattttggtcataccttcgggcatgctttggaaggtgct
tccaattttgaagtgagccatggcatagcggttgggttaggcatgctgattgctattaac
tatgcccaagtgagcggtggcctggagcacattccggcggatactcaacagttgaaagat
tatgtcattggcttattggatgaaattccgatgctgaaggaaattatccagcgaattgat
gtggaaaaagtctttgagtgttttatatccgataaaaagcattccaccagtcattttatt
attatcagtgtgaatggttccggagcgttagaacggttatttatcgataaaaccgaggca
aatataatcaatttgaagtctgcgattagttcagtcattagtcagagctacaaataa

DBGET integrated database retrieval system