KEGG   Methylomonas sp. LW13: U737_23340Help
Entry
U737_23340        CDS       T05879                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
metl  Methylomonas sp. LW13
Brite
KEGG Orthology (KO) [BR:metl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    U737_23340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE UPF0016
Motif
Other DBs
NCBI-ProteinID: QBC29613
LinkDB All DBs
Position
complement(5081323..5082135)
Genome map
AA seq 270 aa AA seqDB search
MNLMYTASGFAVGMLVGVTGVGGGSLMTPLLVFLFGFKPAVAVGTDLLYASITKTAGVFV
HHGKHGSVDWKIVGWLALGSLPFAGVTLYVLKNLMEVGKEVTGAITFTLGVALLLTALAL
LVRSILLRKASKSAEIDDEHSNQGNSGRFSPRWEKVATVFTGAVLGVLVTLSSVGAGALG
TVALLFLYPRMTTLKIVGTDLAHAIPLTAVAGLGHLSLGNFDLDLLISLLLGSVPGIWVG
SHLSAKIPEYFLRPVLATLLLVIGLKFVLQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatgtatacggcatccggttttgccgtgggtatgttggtgggtgttaccggg
gttggcggcggttcgttgatgacaccgcttctggtgtttttgtttggctttaaacccgcc
gtcgcggtaggcacggatttactgtatgcgtcgattacgaaaaccgcaggggtgtttgtt
catcatggtaagcacggttcggtagattggaaaatcgtcggctggttggcgttgggtagt
ttgccttttgcaggtgtaacactttacgtgttgaaaaatctgatggaggttggcaaggaa
gtgaccggtgcaattacctttaccttgggtgtggctttgttgctgaccgctctggccttg
ctggttcgcagtattctgttgcgcaaagcgtccaagagtgcggagattgatgacgaacac
agcaaccagggaaatagtggccgattttcaccacggtgggaaaaagttgcaacggttttt
actggtgcggtgctgggggtgttggtgacattgtcgtcggttggtgccggagctttggga
accgttgctttgctatttctttatccaagaatgacgaccttgaaaattgtcggcaccgat
ttggcgcacgcgattcctttaaccgcggtagctggtttggggcatttgagcctggggaat
ttcgatctggatttactgatcagcttgctgctggggtcggtgccgggtatttgggtcggc
agtcatctaagtgcgaagattcccgaatattttttgcgtccggtgttagcgactttactg
ctggtgataggcttaaaattcgtattgcaataa

DBGET integrated database retrieval system