KEGG   Methanosarcina sp. MTP4: MSMTP_0091Help
Entry
MSMTP_0091        CDS       T03850                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
metm  Methanosarcina sp. MTP4
Pathway
metm00630  Glyoxylate and dicarboxylate metabolism
metm01100  Metabolic pathways
metm01120  Microbial metabolism in diverse environments
metm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:metm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSMTP_0091
Enzymes [BR:metm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MSMTP_0091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKB23560
UniProt: A0A0E3NU53
LinkDB All DBs
Position
119060..120340
Genome map
AA seq 426 aa AA seqDB search
MRRDYVDPGYSPKDTDLICEFHIEPAAGVSFEEASTHMAGESSIDSWTEISTLSPELAAK
LKPHVFYLDEGTKSVRVAYSEELFELGSVPQVLSAVAGNIFSMKIVDNLRLQDISFPKSM
LREFKGPNFGLSGIRDIVGIKNRPLIGTIVKPKVGLTSEMHAEVAYNAFAGGCDLVKDDE
NLTDQKFNRFEKRAELTLKLAEKAEVETGERKMYLCNITAPTCEEMIRRLHVLKDLGASY
AMIDIVPTGWTALQTLREAAEDEGLALHAHRCMHSAFTRNPRHGVSMLLVAKLCRLIGLD
QLHIGTVVGKMHGDKDEVLSIRDECVLETVLADPGQSVLAQDWEGIKPMFPVASGGLAPT
MIPDLYSIFGKDVIMQFGGGIHAHPMGTAPGATACRQALEASMEGFTLEEYAKDRKELGA
ALEKWA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagggactacgtagacccgggctacagcccgaaagacacagatctgatctgtgaa
ttccacattgaaccggcagcaggagtaagttttgaggaagcttccacccatatggcgggg
gaaagttccatcgattcctggactgaaatttctaccctgagccccgagcttgcggcaaaa
ctgaaaccccatgtcttttatctggacgaggggacaaaatcggttcgagtggcttattct
gaagagctctttgaactcgggtccgtcccccaggttcttagtgcggtggcaggcaacatt
ttcagcatgaagattgtggataacctgcgcctgcaggatatcagcttcccgaaatccatg
ctccgggagttcaaggggccgaacttcgggctttccgggatccgggatatcgtagggatt
aaaaataggcccctgatcgggacaatcgtcaagccgaaagtaggcctgacctcggaaatg
catgcggaagtggcatacaatgcttttgcagggggctgtgaccttgtaaaggatgacgag
aaccttaccgaccagaagttcaataggtttgaaaagagggccgaactcaccctgaaactt
gcggaaaaggcggaagtcgagaccggggaacggaagatgtacctgtgcaacatcacggct
cctacctgtgaagaaatgatccggcgcctgcatgtgctaaaagacctcggagcaagttac
gccatgatcgacatcgtgcccacgggctggacagccctccagactctccgggaagcagct
gaagacgaaggcctggcgctccacgcccaccgctgcatgcactcggcattcacaaggaac
cccaggcacggggtcagcatgttgctagtagctaaactctgtcggctgatcgggcttgac
cagctccatataggtactgtcgtcgggaagatgcacggggataaagacgaagtcctttcg
attagggacgagtgtgtactcgagaccgtgctcgcagatcccggacagagtgtccttgcc
caggactgggaaggaatcaaacctatgttcccggtagcctcgggagggcttgccccaacc
atgatcccggacctctactccatcttcggaaaagacgttatcatgcagtttggcggcgga
atccatgcccatcctatgggaactgcacctggagcaactgcctgcaggcaggcgcttgaa
gccagcatggaaggtttcaccctggaagaatatgcgaaggaccggaaagaactcggggct
gcccttgaaaaatgggcctga

DBGET integrated database retrieval system